IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The NKG2D ligand ULBP4 binds to TCRgamma9/delta2 and induces cytotoxicity to tumor cells through both TCRgammadelta and NKG2D. The NKG2D ligand ULBP4 binds to TCRgamma9/delta2 and induces cytotoxicity to tumor cells through both TCRgammadelta and NKG2D. Blood 2009 imex curation Kong Y., Cao W., Xi X., Ma C., Cui L., He W. Interactions involving the chimeric protein TCRgamma9/delta2-OT3-Fc have not been included as the biological relevance of these interactions is unclear, and the exact protein sequences used are not specified. (gamma9/Delta 2 are only in human + primates (Q99603).) The TCRgamma9/delta2-OT3-Fc protein: there are identifiers given for every segment (A0N8U5 and Q99603 + peptide for OT3 (CDR3) =in Ref 30/31- but how they are linked together is unclear, and the ECD regions are not given, nor available in Uniprot. CRD3 is main hypervariable region "responsible for recognizing processed antigen". heweiimu@public.bta.net.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Kong Y., Cao W., Xi X., Ma C., Cui L., He W. Interactions involving the chimeric protein TCRgamma9/delta2-OT3-Fc have not been included as the biological relevance of these interactions is unclear, and the exact protein sequences used are not specified. (gamma9/Delta 2 are only in human + primates (Q99603).) The TCRgamma9/delta2-OT3-Fc protein: there are identifiers given for every segment (A0N8U5 and Q99603 + peptide for OT3 (CDR3) =in Ref 30/31- but how they are linked together is unclear, and the ECD regions are not given, nor available in Uniprot. CRD3 is main hypervariable region "responsible for recognizing processed antigen". heweiimu@public.bta.net.cn Accepted 2017-OCT-19 AT 16:54 BST AT 16:54 BST by PPORRAS Blood 2009 Only protein-protein interactions imex curation imex curation rae1e_human Retinoic acid early transcript 1E NKG2D ligand 4 Lymphocyte effector toxicity activation ligand RAE-1-like transcript 4 UL16-binding protein 4 RAET1E LETAL N2DL4 ULBP4 UNQ1867/PRO4303 protein protein human Homo sapiens Human MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS 3309279B51B603C8 nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV DIP protein P26718 original sequence version: 106 C22F6BD533D7800E klrk1-raet1e-4 1 2 unspecified role unspecified role neutral component neutral component ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line 3 unspecified role unspecified role neutral component neutral component n_terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc physical association physical association 3A