DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. DIP original experiment: DIP-134182X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down predetermined predetermined participant predetermined Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. DIP original experiment: DIP-134184X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down predetermined predetermined participant predetermined Inagawa T., Yamada-Inagawa T., Eydmann T., Mian IS., Wang TS., Dalgaard JZ. DIP original experiment: DIP-134183X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Schizosaccharomyces pombe Rtf2 mediates site-specific replication termination by inhibiting replication restart. rtf2_schpo Replication termination factor 2 rtf2 SPAC1D4.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGNDGGSLPTRNELVKEPGKVPPLDIDFKRSVKSSQFSQCAITDEPLYPPIVSCGLGKLYNKASILQMLLDRSSVPKSPSHIKSLKDVVQLQVELDDSGKVLWLCPITRHVMSDTYQFAYIVPCGHVFEYSALKQFGEKMCFQCNQVYEEKDVIPINPNAEQLKTLSKRLLDLALSEKTHSLNKASKKSNKNGDKKRKHVSKSNSKHAKHELRTNRMLDGENVKSETSVTDMERVKRVKI 6C05265CE64DD889 pcna_schpo Proliferating cell nuclear antigen pcn1 pcn SPBC16D10.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSMLIKSDGFEPYRCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNLVFESEKNDRISDYDVKLMDIDQEHLGIPDIEYDATITMPAAEFQRITRDLLTLSDSVTINASKEGVRFSCKGDIGNGSTTLKQHTDLSDQDQSIEISLTQAVTLTFSLKYLAQFTKATPLATRVTLSMSNDVPLLVEYKMESGFLRFYLAPKIGEEDEE 1EE5B2A27A899C4E 1EE5B2A27A899C4E pcn1-rtf2-1 2 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 4 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association rtf2-pcn1-1 1 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait Q10154:p.Cys141Gly C141G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C G This feature has been corrected as a result of our quality control procedures. The original label was 'C141G'. Wed May 02 15:43:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys141gly' Tue Jun 30 18:14:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141Gly' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pcn1-rtf2-2 3 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 4 unspecified role unspecified role prey prey Q10154:p.Cys141Gly C141G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C G This feature has been corrected as a result of our quality control procedures. The original label was 'C141G'. Wed May 02 15:03:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys141gly' Tue Jun 30 17:46:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141Gly' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association