DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Nature structural & molecular biology 2009 imex curation Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. DIP original experiment: DIP-133018X Nature structural & molecular biology 2009 IMEx Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Nature structural & molecular biology 2009 imex curation Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. DIP original experiment: DIP-133016X Nature structural & molecular biology 2009 IMEx Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Nature structural & molecular biology 2009 imex curation Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. DIP original experiment: DIP-133019X Nature structural & molecular biology 2009 IMEx Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Molecular mimicry of SUMO promotes DNA repair. Nature structural & molecular biology 2009 imex curation Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Prudden J., Perry JJ., Arvai AS., Tainer JA., Boddy MN. DIP original experiment: DIP-133017X Nature structural & molecular biology 2009 IMEx Molecular mimicry of SUMO promotes DNA repair. ubc9_schpo SUMO-conjugating enzyme ubc9 hus5 ubc9 SPAC30D11.13 Ubiquitin-conjugating enzyme E2-18 kDa Ubiquitin carrier protein hus5 Ubiquitin carrier protein 9 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSLCKTRLQEERKQWRRDHPFGFYAKPCKSSDGGLDLMNWKVGIPGKPKTSWEGGLYKLTMAFPEEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEGWKPAITIKQILLGIQDLLDDPNIASPAQTEAYTMFKKDKVEYEKRVRAQARENAP 4BF3A6389203D27F 4BF3A6389203D27F rad60_schpo DNA repair protein rad60 rad60 SPBC1921.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDNLDEDDLAFFSKPIKKPPLNYAKQLIASSSDSEEESELDTNKQALEHINAQKNITHNENKSAEPLSRQSTILDADEGNQDVSDTTPNACLNEGRHSPKSAISCVTQPVSPVYNTRAAANLRNNSINSEAALSTTSSLLDDDFARRLEEIDRQVQEFEKSSSDMDVQIHTHKREIEEDDDNTSADVPLLKHSKSDHSTLYHSKSEFSTNEPVISVVLQLAVIGQRIPNSNISLPRDWEAPLFFKVKSNQQFRRVRIAYSERKKVDNVVLVFQNQRLWDYGTPKGAGMLKVDTRLVVHAYCHSDFISLKRIKELEVEKLSSVTEDSTAQTCKLITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFHERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVLD 5FF406D9FC791983 5FF406D9FC791983 uba2_schpo Ubiquitin-activating enzyme E1-like uba2 SPBC16H5.03c Pmt3-activating enzyme subunit 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPTLMQLSNDMKPLTFVEALRNFKSAKVLLVGAGGIGCELLKNLLMSGVKEVHIIDLDTIDLSNLNRQFLFRKKHVKQPKAIVAAKTASSFNPNVKLEAYHANIKEDRFNVAWFRQFDLVFNALDNLDARRHVNKQCLLASVPLIESGTTGFLGQVQVIIHGKTECYDCNPKEPPKTYPVCTIRSTPSQPIHCVVWAKSYFFPQLFSNDQESDGIIDNVSANEMERREIAELARETTELNELRSSIGQSDNGFEKIFTKMFTKDIVRLREVPDAWTYRSPPKELSYSELLENAEKATSPWLNEQNVWNVAESFAVLRDSIRRLALRSKSSKDDLSFDKDDKDTLDFVAAAANLRAHVFGIQQLSEFDIKQMAGNIIPAIATTNAVIAGLCITQAIKVLQGDLNDLKNIYLAKRPTRVLHCEKTCKPNPYCPTCSFVLLQLGVNDKNMTLRVLVDDILKSRLHYSEEVSVLNDKLIYDPDFDDNLDKTFDDLGINPAKNTILTVLGDSAVEKDDDGEEATRVPLLIEVTFIDSNSTEGLPYQILSNATSIPLKQQPPSNSPEDSQVLTDEINEVNDFSSSERIVINLDEYDIIVDSKTSSHNKQLKRRPSNDTLTQEAKSKKQAKIHTM AAC9247BB8D2F634 AAC9247BB8D2F634 pli1_schpo E3 SUMO-protein ligase pli1 pli1 E3 SUMO-protein transferase plil SPAC1687.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNQANFLQELPNVLKRLETGLIIPQLKDILRVFGLRLSGTKAELITRIKQLIERIAIENNTTSWEALKKAIDGDVTSAVCILKYNTYQIYSAAAPIAPPSSASGNRSYSRPFAPVVHSRIRFRKSPFYDILEQFNAPFVVPACVGTRNTISFSFHVTPPALSKLLNDPKQYRVYLFSTPSETIGFGNCLMEFPTPQMELRINNQVAHANYRRLKGKPGTTNPADITDLVSKYAGPPGNNVVIYYMNSTKSYSVVVCFVKVYTIENLVDQIKSRKAESKEKIIERIKNDNQDADIIATSTDISLKCPLSFSRISLPVRSVFCKHIQCFDASAFLEMNKQTPSWMCPVCASHIQFSDLIIDGFMQHILESTPSNSETITVDPEGNWKLNTFDEPVESSEDEFVPKEKVIELSDGEGISTMANKSNDQPTRRASTHNSGPPAKRKRESLVIDLTISDDDENVATSTTESPSNATKENSLSRNVQSPNIDTAISNRSTNVRHGHPGFKDYTVENSPASRERSTSESAQSSVHMGYAGEGGLLSGALRAPSQQNNNNSNTQHSINLHTIVPSPYEPPLSVTPSTAITNLSIPESNRTNSSASSKSFTMNDLILPPLHLKNTTQTNNAHEDAQSSNLSQNHSLFYERIPQRPSYRIEKQNKGIYEDENEQSISAMPIPRAHPQLPKNLLSQTAGPLWDEQQDAQVDWNSELQSNNSYHNSGFEGTGNTFQSID 56228A04888DD235 56228A04888DD235 rad60-ubc9-1 2 5 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 6 unspecified role unspecified role bait bait Region 332-406 Region 332-406 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9USX3:p.Glu380Arg E380R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E380R'. Wed May 02 14:29:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu380arg' Tue Jun 30 19:48:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu380Arg' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association rad60-pli1-1 1 8 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 6 unspecified role unspecified role bait bait Region 188-331 Region 188-331 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association rad60-fub2-1 4 6 unspecified role unspecified role bait bait Region 188-331 Region 188-331 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 7 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association ubc9-rad60-1 3 5 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 332-406 Region 332-406 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9USX3:p.Glu380Arg E380R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E380R'. Wed May 02 15:23:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu380arg' Tue Jun 30 19:26:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu380Arg' ecolx Escherichia coli direct interaction direct interaction