DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions synechocystis sp. pcc 6803 Synechocystis sp. PCC 6803 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134083X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134091X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134095X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134108X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134086X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134105X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134098X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134096X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134102X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134104X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134093X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134088X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134109X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions synechocystis sp. pcc 6803 Synechocystis sp. PCC 6803 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134082X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134094X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134107X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134087X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134089X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134103X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134080X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134084X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134106X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134101X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134085X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134097X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134099X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134100X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134090X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134092X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Osanai T., Imashimizu M., Seki A., Sato S., Tabata S., Imamura S., Asayama M., Ikeuchi M., Tanaka K. DIP original experiment: DIP-134081X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx ChlH, the H subunit of the Mg-chelatase, is an anti-sigma factor for SigE in Synechocystis sp. PCC 6803. p74686_syny3 ski2 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MKTLAYANPADLFAFPLDDFQQEAIAALDQDQSVVVCAPTGSGKTVVGEYAIYRAIARGKRVFYTTPLKALSNQKIRDFQEKLEKLGLENAAQLVGLITGDTVINADAPVVVMTTEIFRNMLYETPIGEVGTSLEDVETVVFDEVHYISDRGRGTVWEESIIYCPSTIQLVGLSATIGNPEQLTEWINQVRTGVSLKVLRQGEQRNDSPPCVLVNSDFRPVPLTFHYSTRKGLFPLLNEKKTGVNTRLLPKAGNKNTRSGKNRRMRREDCPYPLLVMQQLQERNLLPVIYVIFSRRGCEQAAQSLEDLSLVEPAEQESIQLQLLDFFFGKNPLLRQKLERDLANGLPDLVQAVVAYLDHPQDSEAAQRLLTALAIDPEGMFKLWGWIAQSSPMTRFEQIEPLLRGIAVHHAGILPDMKTLVEKLFEQGLIKVVFATATLSAGINMPARTTVISALSKRTNEGHAMLSPSEFLQIAGRAGRRGMDTEGHVITVQTPFEGANEASYLALAEAEPLKSWFTPSYGMVLNLLQKHDLEEVKSLLERSFAEYLAQFALEPTKVAIAETVKKLSQLDIKLAGIGEKDLRSYEKFRGRLREEQRLLKILEEQAEKERKQQLKDQLKTLAPGQLLYLKGRHVKIHQPRLAVIVAPLAPAHNLPQWCCLGSDNRWYHVTVGDIYAVPIGNLSPAQWQHLTPPPAELLAPGKSVKGDEETLAIAAGLDPQTYPLEPSPELVEQQARVDHVEKLLAVHPLASQKHPGKLLEQFHQRQELRKTLSKRQQEYDRLQSRQSYYWQEFLDLIDILQEMEALEEYTPTLLGEVAATLRGENELWLGLALISGKFNDLEPEQLAAAASALITETPRSDAWTDFKPSPVVLAALRPSNDLFGLLFCLKHPQPPLALWQAMTVADHLQRLNLWDLRRKLIKAQNQRAIAIPLWLEVDFMGLVEQWALGMEWENLCRQTSLDEGDLVRLFRRTVDLLWQIPQVPHLSPRLKRNARIAVQQMKRFPL A0B3C5CEA2319C12 A0B3C5CEA2319C12 muts2_syny3 Endonuclease MutS2 mutS2 mutSB sll1772 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSDSTNLTIAEETLALLEWPRLCQHLSTFTQTPLGAIAARYLLPPSQWEESRELLAQTQAVESIENSPESNWHFKGIADITEPLARVERGGLVTGLELLAIAGTLAGVRRLRRVIEERDDLEILQTLVAEVRTLPELEQAIHHCLGEDGKVAERASPKLGEIRQKLKAVREQIQQKLQKIIQRQSNALQEAVITQRGDRFVLPIKAGYKEQMPGIVHDSSASGNTLYVEPQAIVELGNKLRQARRQEQTEEERILRQLSDQVLEVLLDLEHLLAIATRLDLATARVRYSFWLGAHPPQWLTPGDEKPITLRQLRHPLLHWQAEKEGGPAVVPITLTIDSQIRVIAITGPNTGGKTVTLKTLGLVALMAKVGLYIPAKETVEMPWFAQILADIGDEQSLQQNLSTFSGHICRIIRILQALPSGVQDVLDPEIDSPNHPIFPSLVLLDEVGAGTDPTEGSALAIALLRHLADQPCLTVATTHYGELKALKYQDARFENASVEFDDQSLSPTYRLLWGIPGRSNALAIAQRLGLPLAIVEQAKDKLGGFSEDINQVIAGLESQRREQEQKAANAQKLLQETEIFYQQVSQKAASLQARERELKSYQDQEVQQAIAAAKEEIAKVIRQLQRGKPSAQKAQQATEILGQIQAEQKAKVAPKPIGYQPTVGERIRIPSFGQTAEVTQVNATAQTVNVTLGLMKMTVPMADIESLNGKKVEPPPKSEPVPKKVKAEPPATEAKSPPVLVRTEKNTLDCRGDRLERAESRLEKALNQALDAGVLWIIHGKGTGKLRQGVQEYLSHHPLVKSYALAPQNDGGAGVTIAYLR 78AE7942F777F721 78AE7942F777F721 p73666_syny3 rpoD protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTARTSPDSVRAYLREIGRVPLLTHEEEIVYAKQIQQVVSLNEIKKSLAEGKDGEPVSPSEWAKAADLSIRELEKAIKEGERAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFDPTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLSQEKGRAASIAELAEHLELTPKQVREYLERSRHPLSLDLRVGDNQDTELGDLLEDDGPLPEDFATYASLQLDLDSLMAELTPQQREVLILRFGLNDGQPLTLASIGSMLSISRERVRQIEREALNKLRKRKSMIQEYLAS D93942CEB50C0D21 D93942CEB50C0D21 p73518_syny3 Single-stranded-DNA-specific exonuclease RecJ recJ protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MAQFRWQLIPPVTPPAIFVEQVRRHCGQSSGQFAAQLLWQRGIQSADQLGGFLSPDCYTPTSPWEFGQEMKWAVQRLGQAMAQKEKVTIWGDFDADGITSTAVLWEGLGQFFPQDSQLTYTIPNRLRESHGLNRPGLERLATQGTKLIVTCDTGSTNLDEIVYAQQLGMDVIVTDHHTLPDDRPEVVAIINPRYFADGHPLFNLSGVAVAFKLVEALYNQYPTVPQQPLEDLLDLVAIGLIADLVTLQGDCRYLAQRGIAQLRTQKDPATATRPGIHALLNLCNRNGDRPTDIGFGIGPRINAISRIKGDASFGVELLTSRDTKVCNQLAAEAETLNSRRKGLQKSVIIEIDQRLQNIDLSTTGVVVLTDPQWPTGVLGLAASHVAQTCGRPAILLNTQDGKIAKGSARSVANIDLYALLHSQRHLMLGFGGHPFAAGLSLPLDKLPLFTEAVNQQFWQSYGAQISLDPILAVDLQVKVADLGQDLFREFNLLEPYGMGNPAPKLLLENVQVGRPSFRNIKDRTGNKVSYLKTSFRVTDYPPKTDDDGQVVQCPGVWWGHHPDELPQNEPLDLVVELDFNTYDRQYEVRLIDFRLHQPQGIAPSQTSTNLIDRRSPHAPDQDLSPQGHVLRTCPSSWSELRRAYQQAIAAQQPLVLDYHFLPQCPSSLVAELEAQWHGRETAQLSPLSLQKQWDFSHGLASQILVLIQEYGPALNSGSAWPKALVRQIETLIAEEQFQKQYFSQVSLTPELLATVPDKP 1A749046371EF73A 1A749046371EF73A sya_syny3 Alanine--tRNA ligase alaS Alanyl-tRNA synthetase sll0362 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTTTPPVLSGPEIRQQFLNFFADRQHQILPSASLVPEDPTVLLTIAGMLPFKPIFLGQKSAEFPRATTSQKCIRTNDIENVGRTARHHTFFEMLGNFSFGDYFKSQAIAWAWELSTQVFKLPAERLVVSVFEEDDEAFAIWRDEIGIPAHRIQRMGADDNFWVSGPTGPCGPCSEIYYDFHPELGDEKLDLEDDSRFIEFYNLVFMQYNRDNAGNLTPLEKKNIDTGMGLERMAQILQKVPNNYETDLIFPIIQTAANIAGIDYAQANEKTKVSLKVIGDHVRSVVHMIADGISASNLGRGYVLRRLIRRVVRHGRLLGINGEFTTKVAATAVQLAQPVYPNVLERQSLIEQELQREEAAFLKTLERGEKLLADLMADGVTEIAGADAFTLYDTFGFPLELTQEIAEEQGITVDVEGFEKAMQEQQERSKAAHETIDLTVQESLDKLANHIHPTEFLGYTDLQSSAIVKAVLVGGELVDQAVAGQTVQIVLDQTPFYGESGGQIGDKGFLNGDNLLIRIEDVKRESGIFIHFGRVERGTVQIGTTITATIDRACRRRAQANHTATHLLQSALKRVVDEGISQAGSLVDFNRLRFDFNSPRAVTMEELQQIEDLINQWIAEAHQTEVAVMPIADAKAKGAIAMFGEKYGAEVRVIDVPGVSLELCGGTHVANTAEIGLFKIVAETGIAAGVRRIEAVAGPSVLDYLNVREAVVKELGDRLKAKPEEIPDRVHQLQQELKASQKQLEALKQELALQKSEQLLTQAQTVGEFKILVADLGTVDGESLKTAAERLQQKLGESAVVLASIPEEGKVSLVAAFSPQLVKTKQLKAGQFIGAIAKICGGGGGGRPNLAQAGGRDASKLPEALATAKQTLLAELG 2E68212CA2579A77 2E68212CA2579A77 p73008_syny3 mcpA protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MATETNFSQLYGLAYAAYGQGNYQEASSHIEQLAADFPEDPNVLLLRGHIYVGLEQYALAHQAYQGVIRFSDRQDLIDCANQALGQIQEEEPRGNGAKDSLDQDWQSDIDAIDNSMAWETGVFTEEDFGEPTLGRAPSPTNPGMDHPFGRSSASFGTSGARSYEIENLDWSPEAFTDDLDSDDEQTMMPQTGESTFVVPPAFGEGIADFADLAADVSSAGIGGTDGAEYPPYQTWDGGDWSEALGLDDPEALAQAPTPTSGDYGAGNNLPSFDAFEEGVEDELSDFNLTDIAPELPDSSLFSQATNLDIGAVGRIDDTQGGDTVVHGGNAAPPGMATWLKPDGAATGDLSSATSPFNDRPTSEVDAGFLGWFTNASLFRKQIYMAIASGVFSGFAVLVLGSIVGLGGTPKDVPAPSGETTTEAPAEGAPAEGQAPSQTPEEEPGKPSLLNLAFLTAIATAIGVFLINRLLMQQIKSIIDDLQNQFESIYEGNFNVRAKVRSEDELGALTQRFNYISQVILTATSEAQERAATTEKVREKLQRQVIRLLDDVEGASRGDLTVQAEVTADELGAVADAFNLTIQNLREIVLQVKNAAKQVNNNCKDSESFARNNSSDALRMAEELAVTLNSVQLMTESIERVAENAREAEEVAHTSSLTALKGGEAVERTVGGILQIRETVSETARKVKRLAEASQEISKIVAVISQIASRTNLLALNASIQAARAGEAGRGFAIVADEVRQLADRSAKSLKEIEQIVLQIQSETGSVMTAMEEGIQQVIDVTDKSEQSKRALEDIIEVSNRINTLVRSITADTVKQQENSGAVSNVMQSIELTAQETSQESQRVAGSLQTLVSISRDLLTSVERFRVESR 4A78F2ABAA6FDC88 4A78F2ABAA6FDC88 xer_syny3 Tyrosine recombinase slr0733 xerC slr0733 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MFLPSPNNLSGLNQNILEELLRDKRSPNTRRTYAKALKDFFLTMAGEEPSPDVIAWFLSLDHFQAIAMVLRYRAELLAKDLKPATINVRLAAIKSLVNYARRVGKCQYTLEDVEGLKAETYRDTTGVSPTSFKQITDHITPDSLKGKRDLAIMRLLWDNALRRAEVCGLNVGDYQPTERQLLIKGKGKLGKQAITLSAKGMALINQWLTAIGPRPKNEPLFCTLDRATFGHRLSGNAIYNLVRTSAESAGIHKVMSPHRVRHSAITAALEATNGDTRKVQKLSRHSNLNTLMIYDDNRHQHQAQITDILADLL BC40C9A256EA000C BC40C9A256EA000C crhr_syny3 RNA helicase CrhR crhR deaD slr0083 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTNTLTSTFADLGLSEKRCQLLADIGFEAPTQIQTEAIPLLLSGRDMLAQSQTGTGKTAAFALPLMDRIDPEGDLQALILTPTRELAQQVAEAMKDFSHERRLFILNVYGGQSIERQIRSLERGVQIVVGTPGRVIDLIDRKKLKLETIQWVVLDEADEMLSMGFIDDVKTILRKTPPTRQTACFSATMPREIKELVNQFLNDPALVTVKQTQSTPTRIEQQLYHVPRGWSKAKALQPILEMEDPESAIIFVRTKQTAADLTSRLQEAGHSVDEYHGNLSQSQRERLVHRFRDGKIKLVVATDIAARGLDVNNLSHVVNFDLPDNAETYIHRIGRTGRAGKTGKAIALVEPIDRRLLRSIENRLKQQIEVCTIPNRSQVEAKRIEKLQEQLKEALTGERMASFLPLVRELSDEYDAQAIAAAALQMIYDQSCPHWMKSDWEVPEVDFNKPVLRRGRNAGGGQNKSGGGYQGKPGKPRRSSGGRRPAYSDRQQ 7D2801E515DB444B 7D2801E515DB444B q55662_syny3 clpC protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDARIEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAAGGGSGGRTKTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEIRQAGNIILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIERDAALERRFQPVMVGEPSVEETIEILYGLRERYEQHHKLKILDEALEAAAKLSDRYISDRFLPDKAIDLIDEAGSRVRLINSQLPPAAKELDKELRQILKEKDDAVRNQDFEQAGELKDREDEIKKQIRAIASSKKAEGDNGEPEVTSEEIAHIVASWTGVPVNKLTESESEKLLHMEDTLHQRLIGQEDAVKAVSRAIRRARVGLKNPNRPIASFIFSGPTGVGKTELTKALAAYFFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYNEGGQLTEAVRRRPYTVVLFDEIEKAHPDIFNMLLQILEDGRLTDAKGRTVDFKNTLLIMTSNIGSKVIEKGGGGLGFDFADDQAESQYNRIRSLVNEELKNYFRPEFLNRLDEIIVFRQLNKEEVKEISEILLRDVFARLVEKEISLQVTDKFKERIVEEGFNPAYGARPLRRAIMRLLEDVLAEEILSGRLKEGSQALVDIGEDNQVVVIPGETRELIAPGVE D0A3FF031346533F D0A3FF031346533F yc55l_syny3 Ycf55-like protein sll1879 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSESPLTIVIVDEDPVFRLGLITVLGRETGVQVLGEGETLDDLRQQLETLAPSILLIDPQFPRRSQSAWPLLRQLSSAYPQVKICLLTASLEYDQLLAAKTQGIAAYFPKGTAIADLVTGLKQVHFGQTCWPSLQTVNAPPLSLWEKLIWPLFRDGLGQIEQSLQQVQKSLQVPSLSDFDRLFWRGRERELKFAQWLVRNLLPQRLKTWHKATNILTATTTVLPPSPPSPRRSGVRTITLRPPSNLTALGQILQQMPLQVENLTAIPLELDILQPLKRQELLSLGQQQLETTINELKALRITPAQLPENCLSIVAEMWRSLSLTFFGKYCQPKSEFSLEQIQSLLEVYQPIICREKLVKIPFVVPLFHHLLFGEPLVVNQKAYPLGSTEAQQYSDLYAQNLVIQLANSTMVFILNYFADHEAIKLALYEYSMLSSRQVARFRNDLAWYYQFSRYWLNPKQIFESQHTLLYLTPAGIVTTQVYAPRQQELTQLRAVPWFVTIVLECRDALSPRVRSVIEFVGNGLVFLLTQVVGRAIGLVGKGIIQGIGNTWQESRSQQKRSN 52F4246B4DD3C168 52F4246B4DD3C168 q55516_syny3 slr0554 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MFCPYNETPRTLDMESCSGKTDGKMNHLQEWRQSCVDDQLTRLNVTPLLGDAPAQHLLYAEALQRRNDGRVSDGLMKRYAHVASGGWWCSGIDLLSGEKDLWGCFKPDRPRQDGESSKTIKYEHPPKTPTGIFALRVPLHLWERIAAKAGVVLTEEDQDPDQPDLGFWQWLMGHPEIPLVITEGAKKAGALLTAGYGAIALPGVHNGYRTPRDDQGQRIGKCQLIPALGKLAAPGRQILIAFDQDSKPKTIQQVNLAIQRLGYLFSRQGCEVKVLQWEHHLGKGVDDVIAHQGSDYLQQLVGKALPLEIWKAQRLNRLTHSRGMEVEARYLPPLTIPAEEKLIALQSPKGTGKTEFLARIVRQAQAEHRPVLVIGHRIRLVQELCHRFQLPYVGDLSSSPLARQRGFGLCIDSLHGHSQAQFDPEQWQDCLIIIDEVEQVLWHGLNSDTCRRQRVAILRNLKQLLQHSLGGEGQIYVADADLTDVSLDYLISLSGIPLQPYVIRNHWQPGLEEAWPIYHFGENDPKQLVKQLLHHIREGGKPFVCLSAQKLTSAWGTRNLEAYLKKQFPDRRILRIDAESLSDPHHPAHGSLTNLNQVLADYDIVLSSPAVETGVSIDLKNHFTSVWGIAQGIQTATSVCQSLSRIRQNIPRYLWAASYGFNQVGNGATAISKFLTAGHRLTEVNIRLLQQSDLDNLDDLDTGFQAESLLCWAKMAVRINLAMVNYRESILGLLHQEGHQLLGPPPALPSLPVPPSDPDHPLSTVAPQPLQQAIEAVREQNYLADCQAIADAKPLKELEYQQLKKRLVKNSHERQRLRRYELAQRYGIPVTADLVQKDDQNWYQKLRWHYFLTVGRPFLGDRDAKIARLLLDQGQGSLFLPDFNGSQLGAIIGTYDIIGIPILLAHPQRELCALDEDLIALGKLALANRDDIKTVVGIGLAKNASPITIVRRFLEKLGFGIQLTRTKTVEKKRVRIYQITCPQDGREKVFQAWLQGDRQCPGSSEQWMAEYWKKLQSSPRAEEQHQPFVQLSLELG DFFEE37A527181A3 DFFEE37A527181A3 gln1b_syny3 Glutamine synthetase glnA Glutamate--ammonia ligase Glutamine synthetase I beta slr1756 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MARTPQEVLKWIQDENIKIIDLKFIDTPGIWQHCSFYYDQLDENSFTEGIPFDGSSIRGWKAINESDMCMVPDPNTATIDPFCKEPTLSMICSIKEPRTGEWYNRDPRTIAAKAVEYLRGTGIADTVYFGPEAEFFLFDDIRFGQTENSSYYFADSVEGRWNTGREEEGGNLGYKPGYKQGYFPVAPTDTAQDIRTEMLLTMAGLCVPIEKHHHEVASGGQNELGIKFDKLVNSADNLMIYKYVIKNVAKKYGKTVTFMPKPIFNDNGSGMHVHQSLWKDGQPLFAGDKYAGFSQMGLWYIGGILKHAPALLAFTNPTTNSYKRLVPGFEAPVNLAYSQGNRSASVRIPLSGGNPKAKRLEFRCPDATSNPYLAFAAMLCAGIDGIKNQIDPGEPLDVDIYDLSPEELAKIPSTPGSLEAALEALEKDHEFLTGTGVFSPDFVESWIEYKLDNEVNPMRLRPHPYEFSLYYDC 75F8E28EB5EA9515 75F8E28EB5EA9515 q55525_syny3 rpoD protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MVTVTVILLLFIKESFRMPTANLSSPTSPPTFTADMVRSYLHEIGRVPLLTHEQEIILGKQVQQMMALLEHKKALADRLGREPSDPEWAEAADLSVTKLHRYLGQGERAKRKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGSLGLERGVEKFDPTKGYKFSTYAYWWIRQAITRAIAQQGRTIRLPIHITEKLNKIKKTQRELSQQLGRSATPAEVAKALEIDPSQIREYLSLSRQPISLDVRVGDNQDTELSELLEDEGVSPDAYITQESMRQDLQNLLAELTPQQQAVLTMRFGLNDGQELSLAKIGQHLNISRERVRQLENQALAQLKRRRANMAEYIIAS B0AF566AA258F13E B0AF566AA258F13E p73516_syny3 slr1444 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) METTHSFGDRAVFAFGKHTGKIFKYAPRVLKDQDPEDLHQLRVGVRRLRTAVIGFMPAVQLPQGITERKIGKIGQQLGVQRDNDVLQEILLHKYLPHLPTSEQGCLEKVLKRLQKERKQAFKATYKLLTHDKFTQFKQSWEIWLEHPHFTSLGGLAIADVLPDLLLPQLSQFFLHPGWLVGTEIDPDTNSSNRQRRCIDLSPTAIETLLDGEESILHDLRKEAKRTRYQMELFSDYFGEEYQQLLAQVKMTQEILGNLQDSFVLRAMVEQYLDVDLKQLCPQWSAIFHGDRLGYWDQWQPLQSQFIDPVYRHHCRQLVQNPLVNSDQPTSSNL F713BB208AAE47C1 F713BB208AAE47C1 ilvc_syny3 Ketol-acid reductoisomerase (NADP(+)) ilvC Acetohydroxy-acid isomeroreductase Alpha-keto-beta-hydroxylacyl reductoisomerase Ketol-acid reductoisomerase type 1 Ketol-acid reductoisomerase type I sll1363 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MARMYYDQDANLDLLAGKTVAIIGYGSQGHAHALNLKDSGVNVVVGLYSGSKSVAKAEGAGLKVLSVAEAAKAADLIMILLPDEVQKTVYEAEIAPNLVAGNVLLFAHGFNINFAQIVPPADVDVVMAAPKGPGHLVRRTYEQGQGVPALFAVYQDASGQARDYAMAYAKGIGGTRAGILETTFREETETDLFGEQVVLCGGLTALIKAGFDTLVEAGYQPELAYFECLHEVKLIVDLIVEGGLAKMRDSISNTAEYGDLTRGPRIVTEETKAEMRQILDEIQSGQFAREFVLENQAGKPGFTAMRRRESEELIEEVGKDLRAMFSWLKDR 070C9D494F39CD44 070C9D494F39CD44 recg_syny3 ATP-dependent DNA helicase RecG recG slr0020 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MQCSLVEVSVSVDWPRLQKALTVEVERGFQNLQGKQHRFGDFLCLSFGSPPPPGSSPGDRQKWREFAQRFAQYDQLEEAERKSLVASTRRFLHQLRRSLESPPRDSVPKKDLLAQVNRPQVSEPRYPKSGQIELHTPLATVVSQSQHQTKLLKNLGLATVEDLLFYFPRDYLDYAQQVTIAELTAGETVTIVGRVVNCTCFTSPKNQNLNILQIQLRDQTGRIKLSRFYAGKRFAHRGWQEKIKKLYPPQAVVAASGLVKSSKFGLTLDNPEIEVLDRHSPSIDSFKVGRVLPVYPLTEGITADFLRKLVLACQTAIAKLSDPLPQEIREKYELIDLQTAIAQIHFPENTEKLSLARRRLVFDEFFYLQLGFLQRRYEQKQQQQSAIFTPHGELLEKFSDLLPFRLTQAQQRVVNEILQDLNKPSPMNRLVQGDVGSGKTVVGVFAILAALQGGYQAALMAPTEVLAEQHYQKLVSWFNLLYLPVELLTGSTKTAKRREIHAQLSTGQLPLLVGTHALIQETVNFQRLGLVVIDEQHRFGVQQRAKLLAKGNAPHVLSMTATPIPRTLALTLHGDLEVSQIDELPPGRQPIHTSVITAKERPQMYELIRREVAQGRQVYIIFPAIEESEKLDIKAAVEEHKYLTEKIFPNFNIGLLHGRLKSAEKEAALTAFREKQTEIIVSTTVIEVGVDVPNATVMVIENAERFGLSQLHQLRGRVGRGSHQSYCLLVTNSKSNDARQRLGVMEQSQDGFFIAEMDLRLRGPGEFLGTKQSGLPDFALASLVEDQEVLLLAREAAETMMVEDPNLEAHPDLKIKLVQRYEKLLGGEILT F3641AB9105F4A4C F3641AB9105F4A4C tgt_syny3 Queuine tRNA-ribosyltransferase tgt Guanine insertion enzyme tRNA-guanine transglycosylase slr0713 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MPLPSVNFTYQCQARCSHSQARAGIFQTPHGPVETPRFMPVGTLATVKGITPAQLADTQAQMVLANTYHLHLQPGEKIIAAAGGVHKFMGWSGPMLTDSGGFQVFSLSQLRTIGEQGVLFRSPRDGRLIDMTPENSIRIQNALGADVIMAFDECPPGQGDRLMVEQATARTYRWLERCIEAHQRPGDQALFGIVQGGTYLDLRSQAAEQLIALDLPGYAIGGVSVGEAPALIDKVVQHTAPLLPAHKPRYLMGVGTYREMARAIFAGIDLFDCVIPTRFGRHGTALVQGERWNLKNATFREDHRPLDETCPCYTCQTFSRAYLNHLIRSREMLGYILLSLHNITELIRFTQSIRQAILNDTFTQDFAHWLTPPE E8D65D266D6DCB24 E8D65D266D6DCB24 clpb1_syny3 Chaperone protein ClpB 1 clpB1 slr0156 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MQPTDPTKFTEQAWDAIVKSQEVARRYKNTNLEVEHILLALLEQDMGLAARIFQRAAVDGEGLRQQLEIFTNRQPKQAYVEQLYLGRSLDVMLDRADAARSSWEDKFISVEHLLVGFAEDDRVGRKTLRAFNLDPQDLELAIKAIRGSQKVTEPNQEEKYEALDKYGRDLTEQARQGKLDPVIGRDEEIRRVIQVLSRRSKNNPVLIGEPGVGKTAIAEGLAQRIINGDVPESLKNRQLISLDMGSLIAGAKYRGEFEERLRSVMKEVTNSDGQIILFIDEVHTVVGAGGREGSGSMDAGNLLKPMLARGELRCIGATTLDEYRKNIEKDPALERRFQQVYVKQPSVDDTISILRGLKEKYEVHHGVKITDSALVAAATLSHRYIQDRFLPDKAIDLVDEAAARLKMEITSKPVELEDIDRRLMQLQMEKLSLEGEEKRPGLGADKSSKERLEKIQQEITELEGQQQELSGQWLSEKQMLEEINTLKEKEQELRLQVEKAERATDWEKAAKIKYGELEVLQHDIEEKESKLLEIQGSGNTLLREQVTESDIAEIVAGWTGIPMNRLMETERQKLLQLEGHLHQRVIGQKEAVAAVSAAIRRARAGMKDPSRPIGSFLFMGPTGVGKTELARALAGFLFDSEEAMVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLSEAVRRRPYSVVLLDEVEKAHLDVFNILLQVLDDGRITDSQGRVVDFRNTIIVMTSNIGSDHILSLSADDADYDKMQKQVLQSLRKHFRPEFLNRIDDLIIFHTLKRDELRRIVVLQIKRIEKLLDEQKITLSLSDAALDHIVSAGYDPTYGARPLKRAIQRQLENPIATKILENTFVAGDKILIDCVDGQLIFDKEIEPTTLPEEPEENITAVEVEVLSS 67BBA62136E36D63 67BBA62136E36D63 phy2_syny3 Phytochrome-like protein cph2 cph2 Bacteriophytochrome cph2 sll0821 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MNPNRSLEDFLRNVINKFHRALTLRETLQVIVEEARIFLGVDRVKIYKFASDGSGEVLAEAVNRAALPSLLGLHFPVEDIPPQAREELGNQRKMIAVDVAHRRKKSHELSGRISPTEHSNGHYTTVDSCHIQYLLAMGVLSSLTVPVMQDQQLWGIMAVHHSKPRRFTEQEWETMALLSKEVSLAITQSQLSRQVHQQQVQEALVQRLETTVAQYGDRPETWQYALETVGQAVEADGAVLYIAPDLTGSVAQHYQWNLRFDWGNWLETSLWQELMRGQPSAAMEPMAAVQSTWEKPRPFTSVAPLPPTNCVPHGYTLGELEQRSDWIAPPESLSAENFQSFLIVPLAADQQWVGSLILLRKEKSLVKHWAGKRGIDRRNILPRLSFEAWEETQKLVPTWNRSERKLAQVASTQLYMAITQQFVTRLITQQTAYDPLTQLPNWIIFNRQLTLALLDALYEGKMVGVLVIAMDRFKRINESFGHKTGDGLLQEVADRLNQKLSPLAAYSPLLSRWHGDGFTILLTQISDNQEMIPLCERLLSTFQEPFFLQGQPIYLTASMGISTAPYDGETAESLLKFAEIALTRAKCQGKNTYQFYRPQDSAPMLDRLTLESDLRQALTNQEFVLYFQPQVALDTGKLLGVEALVRWQHPRLGQVAPDVFIPLAEELGLINHLGQWVLETACATHQHFFRETGRRLRMAVNISARQFQDEKWLNSVLECLKRTGMPPEDLELEITESLMMEDIKGTVVLLHRLREEGVQVAIDDFGTGYSSLSILKQLPIHRLKIDKSFVNDLLNEGADTAIIQYVIDLANGLNLETVAEGIESEAQLQRLQKMGCHLGQGYFLTRPLPAEAMMTYLYYPQILDFGPTPPLPKVALPETETEAGQGNVGDRPLPNSLNRENPWTEKLHDYVLLKERLQQRNVKEKLVLKIANKIRASLNINDILYSTVTEVRQFLNTDRVVLFKFNSQWSGQVVTESHNDFCRSIINDEIDDPCFKGHYLRLYREGRVRAVSDIEKADLADCHKELLRHYQVKANLVVPVVFNENLWGLLIAHECKTPRYWQEEDLQLLMELATQVAIAIHQGELYEQLETANIRLQQISSLDALTQVGNRYLFDSTLEREWQRLQRIREPLALLLCDVDFFKGFNDNYGHPAGDRCLKKIADAMAKVAKRPTDLVARYGGEEFAIILSETSLEGAINVTEALQVEVANLAIPHTVSGTGHVTLSIGIAVYTPERHINPNALVKAADLALYEAKAKGRNQWLAYEGSQLPHVDGEV 318CF3A73962D99E 318CF3A73962D99E raf1_syny3 RuBisCO accumulation factor 1 raf1 sll0102 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTHSPESNPTVSAAEAAELIRSLLHKEGTWVDWGKKCQQLQKAGYGAEEIFEQSGFQKVQQNLVIVASQVYESLVKQGIDETVLSYYRGPKSDVLYELRILNHQQRAIAAVEAQQKNLAADEAKELAKAFQEFGYLSQLPEGFTDHPGDALAYQCWKLARQKKNLPERTRLIVKGLKFAHSPNARQAIEKLLTDLTAQPSRKAPLVPVFRLEEDQEAARLIPVAGTFPLQPQAVQAVQSLEQVEPFGLVSYQGEGAVVPVPQWQAILTAEDPVAIFCPAGQVSESLARKDEQVLVVVDRSKKIWNDGSYFLLNQGETVAIQWCETEPEREILAQVVLVLRPKKIFDANNLREPWQMDD 6572E4E8BC4ECA89 6572E4E8BC4ECA89 lpxc_syny3 UDP-3-O-acyl-N-acetylglucosamine deacetylase lpxC UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase sll1508 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MGHTIKAPLTVQGVGLHSGVETTVTLCPVAAGKGRYFQRVDLPKKPIIPADLTWVREAMLSTELGEPGATIRTVEHLLATLVALDIGDLRIEVNGPEVPLLDGSALSWLTAIAKVGTRPRSKKSQDQPIVITDPLTCQLEDAFVAAFPCATTRFSYGVDYPYLPIGKQWYTWEPDQENFATAIAPARTFGFADQIEKLRQAGLIKGGSLENALVCDKEKWLNPPLRFPDEPVRHKLLDLLGDLSLLGKIPQAHFVAYKASHKLHTQLAQKIADTYR AAB7CBBE1B2EE850 AAB7CBBE1B2EE850 p74175_syny3 hlyD protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MNSPTQEHAPQRNGHSSKTMDAGTLADVKEQEKAAKTPVALSSNSSLFQPEQAIVMRQSPMWARGIAIAIMGVTVVAVTWASIATIEQVVPATGQLKPLDTVKDINAPLNGVVKEVLVENNRKVKKGEVLVIMDSSSTRAELTAAQNIRSKVLQENAFYRTLLQNGLEGSTLQRAISQLNLPWEVVALANNRAELINENKLYRQQLGLRNASGEGQLSAEQLSRLEMARFELGSRVTAAELEIRQIEKQLQQASLQLRAERSQLQEDQKILAGLLGRNEAALVEAEKSLAIEAGIVNSMTPLLEEGALARLQVEKQQQSLNDRTQQLIEQKVNTVVEVDRQKQQIESRQAEIQRLETEQSRLQSLISQAQARLANTSAVTDKDIYDRLADNNKRLAEIDSQITKIIVDNDKRLTELNGQIERAKVNLGYQEITSPVDGVVFDLKATPGYVTPPNQTEPLLKIIPADSLVAEVDVTNKDIGFVRTGMPVDVRIDSFPYSEFGGVDGEVEYVGSDALPPDQTYQFYRFPVRIKLDSQELVSHGREIPLQSGMSVTANIRVREKRTVMSIFTELFTKKIESLETVR 4D10C738AF2F32B1 p73271_syny3 slr1142 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MQQAAIPANEQQRLAHLQNLKILDTPSDEKFNRITRLLCRVLDMPVAAISLVDENRQWFKSIRGLDLTETPRCVSFCAHTILEDRTLVISDTLSDLRFADNPLVLEAPHVRFYAGHPLKILDNIHVGTLCVYDTKPREISDDDVQFLEDLAITVANELKAHMFKRFFTV 7D3E2F50CBFB4855 capp_syny3 Phosphoenolpyruvate carboxylase ppc sll0920 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MNLAVPAFGLSTNWSGNGNGSNSEEESVLYQRLKMVEELWERVLQSECGQELVDLLTELRLQGTHEAITSEISEEVIMGITQRIEHLELNDAIRAARAFALYFQLINIVEQHYEQNEQQRNRWEASQETNFYEQAGNEEEMVPPSRLGASTEPLPVGIDQNELQASVGTFHWLMRELKRLNVPPQHIQNLLDHLDIRLVITAHPTEIVRHTIRRKQRRVDRILRKLDQLQGSVTGRDWLNTWDAKTAIAQLTEEIRFWWRTDELHQFKPTVLDEVDYSLHYFDEVLFDAVPELSKRLGQAIKETFPHLRAPRANFCYFGSWVGGDRDGNPSVTPEVTWQTACYQRGLVLGKYLFSLGELVAILSPSLHWCKVSQELLDSLERDRIQLPEIYEELSLRYRQEPYRMKLAYVTKRLENTLRRNNRLANPEERQTMITMPAENHYRTGEELLEELRLIQRNLTETGLTCLELENLITQLEVYGFNLAQLDFRQESSRHAEAIAEIAEYMGVLTTPYEEMAEEDKLAWLGVELQTRRPLIPQEMPFSERTRETIETLRTLRHLQMEFGVDICQTYIISMTNDASDVLEVLLLAKEAGLYDPATASNSLRIVPLFETVEDLKNAPGIMDSLFSLPFYRATLAGSYHSLKELQNQPPDYYQIPTTTALLNPGNLQEIMVGYSDSNKDSGFLSSNWEIHKAQKSLQAVAQSHRVILRLFHGRGGSVGRGGGPAYKAILAQPAGTVDGRIKITEQGEVLASKYSLPELALYNLETLTTAVIQASLLKSSFDFIEPWNRIMEELACTARRAYRSLIYEEPDFLDFFLTVTPIPEISELQISSRPARRKGGKADLSSLRAIPWVFSWTQTRFLLPAWYGVGTALKSFVDQDPVKNMKLLRYFYFKWPFFNMVISKVEMTLSKVDLTIASHYVQELSKPEDRERFDRLFQQIKQEYQLTRDFAMEITAHPHLLDGDRSLQRSVLLRNRTIVPLGLLQISLLKRLRQVTQEAETSGVRYRRYSKEELLRGALLTINGIAAGMRNTG 76DF6061BAB7235D 76DF6061BAB7235D y1322_syny3 Metalloprotease slr1322 slr1322 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MPPTLLLSQDLPSLNYTTPGDRLDGRWRESLSTLLGLGRAAGADFVEFFLEKVNYVSCLAEDDAITSLTPRLSSGCGVRVYKGKGDCYVSTNDISFNGLRTALEKGLSILGLTLPAGQSFVPELNLEMLRDYAGAKEKDQWLHRCSPMQEMSDILLGANQKLDHYASHAQSRRAAYFRDWQEVLVAASDGTFARDIRLTQSVGFSLFCADGEHRTSIGKRSGDTSNPDYLRTWDAETSAQEVAESAGKMLYADYVESGNYPIIMANQFGGVIFHEACGHLLETTQIEHKTTPFLDKKGEKIAHENLTAWDEGLTDNAFGTIDMDDEGMPTQRTLLIENGILKNFIADRTGSIRTGHPRTGSGRRQSYAYAAASRMRNTYIAPGNYSVDDIFNSVEKGIYCKQMGGGSVGATGEFNFAVSEAYLVENGKLTKPLKGATLIGTATEIMNKISMSSQDLGLAAGFCGSVSGSVYVTVGQPHIKVDGITVGGR 9E6DF04372375E25 9E6DF04372375E25 p73020_syny3 Magnesium chelatase chlH protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MFTNVKSTIRRVDPEALNGRQLLKVVYVVLESQYQSALSAAVRNINRTNSSLAIQLTGYLIEELRDPENYANFKHDVSEANLFIASLIFIEDLADKVVEAVTPYRDNLDAAIVFPSMPQVMRLNKMGSFSMAQLGQSKSAIAQFMKKRKENSSGAGFQDAMLKLLRTLPTVLKYLPVEKAQDARNFMLSFQYWLGGSQENLENFLLMLTDKYVYPDLGLDKLVNYQEPVVYPDMGIWHPLSMQMFENVKDYLEWYNQRPDISEDLKDPLAPCIGLIMQRTHLVTGDDAHYVGMVQELEAMGARVICVFSGGLDFSKPVNEYFWDKSVNGVEPLPIVDAVVSLTGFALVGGPARQDHPRAIESLKKLNRPYMCALPLVFQTTEEWEASDLGLHPIQVALQIAIPELDGAIEPIILSGRDGSTGRAIALQDRLEAIAQRAMKWANLRKKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIYEVMKGLQGNGYDVQDLPGSAKELMEAVIHDAQAQYNSPELNIAHRMSVEQYERLTPYSVRLEENWGKPPGHLNSDGQNLLIYGKEFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYYTYLNHIWKADAVLHFGTHGSLEFMPGKQMGMSGECYPDNLIGTIPNLYYYAANNPSEATIAKRRGYASTISYLTPPAENAGLYKGLQELNELIGSYQTLKDSGRGIQIVNTIMDQARICNLDQDVNLPDINAEEMDQGQRDTIVGSVYRKLMEIESRLLPCGLHVIGQPPSAEEAIATLVNIASLDREDEGIWALPTLIAESIGRNMEEIYRNSDKGILADVELLQDITLATRAAVAALVQEQINADGRVSFVSKLNFFKIGKKAPWVKSLCDSGYPNVNEEKLKPLFEYLEFCLEQVCADNEFGGLLQALEGEYVLPGPGGDPIRNPNVLPTGKNIHALDPQSIPTLAAVQSAKVVVDRLLERQRAENGGNYPETIASVLWGTDNIKTYGESLAQIMWMVGAKPVPDALGRVNKIELVPLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKLAAEADEPLEMNFVRKHALEQAEEMGIGVREAATRIFSNASGSYSSNVNLAVENSSWEDESELQEMYLKRKSFAFNSDNPGMMDQNRDMFERALKTADATFQNLDSSEISLTDVSHYFDSDPTKLISTLRDDGKAPAAYIADTTTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAVDNWVYEDANSTFIKDEEMCKRLMDLNPNSFRRMVSTLLEVNGRGYWETSDENLERLQELYQEVEDRIEGVE DD58A4693295F1E5 DD58A4693295F1E5 rpob_syny3 DNA-directed RNA polymerase subunit beta Transcriptase subunit beta RNA polymerase subunit beta rpoB sll1787 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTNLATTMLPDLIEIQHASFHWFLEEGLIEELNSFSPISDYTGKLELHFLGKDYKLKQPKYDVDESKRRDASYSVQMYVPTRLINKETGEIKEQEVFIGDLPLMTERGTFIINGAERVIVNQIVRSPGVYYKKELDKNGRRTYSASLIPNRGAWLKFETDKNGLVYVRIDKTRKLSAQVLLKAIGLSDNEILDSLSHPEFYQKTLDKEGNPTEEEALVELYKKLRPGEPPTVSGGQQLLESRFFDPKRYDLGRVGRYKLNKKLRLNEADTTRVLTPQDILAAINYLINLEFDVGTTDDIDHLGNRRVRSVGELLQNQIRVGLNRLERIIRERMTVSESDALTPASLVNPKPLVAAIKEFFGSSQLSQFMDQTNPLAELTHKRRISALGPGGLTRERAGFAVRDIHPSHHGRICPVETPEGPNAGLIGSLATCARVNDYGFIETPYFRVESGRVRKDLDPVYLTADEEDDMRVAPGDIPTDEEGNIIGESVPIRYRQEFSTTSPEQVDYVAVSPVQIISVATSMIPFLEHDDANRALMGSNMQRQAVPLLRPERPLVGTGLEAQAARDSGMVIVSRTHGIVTYVDATEIRVQPHSPDNPAEKGEEIVYPIQKYQRSNQDTCLNQRPLVYAGEDVVPGQVLADGSATEGGELALGQNILVAYMPWEGYNYEDAILISERLVYDDVYTSIHIEKFEIEARQTKLGPEEITREIPNVGEDALRNLDEHGIIRIGAWVESGDILVGKVTPKGEADQPPEEKLLRAIFGEKARDVRDNSLRVPNGEKGRVVDVRVFTREKGDELPPGANMVVRIYVAQKRKIQVGDKMAGRHGNKGIISRILPIEDMPYLPDGRPIDIALNPLGVPSRMNVGQVFECLLGWAGENLGVRFKITPFDEMYGEEASRDTVHGLLEEASQRPNKDWVFNENHPGKIQVFDGRTGEPFDRPITVGQAYMLKLVHLVDDKIHARSTGPYSLVTQQPLGGKAQQGGQRFGEMEVWALEAYGAAYILQELLTVKSDDMQGRNEALNAIVKGKSIPRPGTPESFKVLMRELQSLGLDIAAHKVQLSEDGESADAEVDLMIDSQRRAPNRPTYESLHTEEDLEEEEV 40235F5EBA7CE881 40235F5EBA7CE881 gyrb_syny3 DNA gyrase subunit B gyrB sll2005 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTMTTTNYGADQIQVLEGLEPVRKRPGMYIGSTGPKGLHHLVYEVVDNAIDEALAGYCTHIEIDINADGSVTVVDNGRGIPTDIHPTTGRSALETVLTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWVEVKVWRQGKEHFQRFERGNPIGTLEATPNEGHSTGTQVSFLPDTQIFKDGIEFDYHTLASRLKELAYLNAGVRITFGDRRADSLKEEQFYYEGGIREYVTYMTTDKTPLHEEIIYTSGEKNDVQVEVALQWCVDAYSDTLLGFANNIRTIDGGTHLEGLKAVLTRTLNSVARKRNKLKDGDSNLGGENIREGLTGVISVKVPDPEFEGQTKTKLGNTEVRGIVDTLVGEALTEFLEFNPGVADAIIEKAVQAFKAAEAARRARELVRRKSVLESSTLPGKLADCSSKDPSESEIFIVEGDSAGGCFSGDTLVALTDGRSVSFEQLVEEEKQGKQNFCYTIRHDGSIGVEKIINARKTKTNAKVIKVTLDNGESIICTPDHKFMLRDGSYKCAMDLTLDDSLMPLHRKISTTEDSGITIDGYEMVWSPRSDSWLFTHLVADWYNRWQGIYIAEEKQHCHHKDFNKRNNNPDNLIRLSPEKHLALHRKHISKTLHRPDVVEKCRRIHQSPEFRRKMSARMQSPETRAILSKQAQAQWQNETYKLTMMESWRSFYDSNEDYRQQNAEQLNRAQQEYWAQAENRTAQAERVRQHFAQNPGLRQQYSENAVKQWNNPELLKWRQKKTKEQWTPEFREKRREALAQTYYRKTLAALKQVEIENGYLDISAYDSYRISTKDKSLLRFDRFCERYFENDENLAREAVLNYNHRIVNIEAVSETIDVYDIEVPHTHNFALASGVFVHNSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGDDFDISSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRDLVDQGYIYIACPPLYKLERGKNHFYCYSDRELQEQISQFPPNANYTIQRFKGLGEMMPQQLWDTTMNPESRTMKRVHIEDAAEADRIFTVLMGDRVAPRREFIETYGTKLDLTDLDI 6CA02586DFEA607B 6CA02586DFEA607B sige-ilvc-1 2 45 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction chih-sige-1 20 43 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 56 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sige-tgt-1 19 47 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-ski2-1 23 31 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-chih-1 30 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 56 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-slr0554-1 9 41 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-lpxc-1 29 51 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-chih-2 14 56 unspecified role unspecified role prey prey synechocystis sp. pcc 6803 Synechocystis sp. PCC 6803 43 unspecified role unspecified role bait bait synechocystis sp. pcc 6803 Synechocystis sp. PCC 6803 physical association physical association sige-mcpa-1 6 36 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-rpob-1 15 57 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-muts-1 11 32 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction chih-sige-2 1 56 unspecified role unspecified role bait bait synechocystis sp. pcc 6803 Synechocystis sp. PCC 6803 43 unspecified role unspecified role prey prey synechocystis sp. pcc 6803 Synechocystis sp. PCC 6803 physical association physical association sige-slr1142-1 22 53 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-ycf55-1 3 40 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-clpc-1 21 39 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-xerc-1 10 37 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-slr1444-1 4 44 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-alas-1 24 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-sll0102-1 5 50 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-gyrb-1 8 58 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-rpod-1 7 33 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-slr1322-1 16 55 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-cph2-1 17 49 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-recg-1 25 46 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-ppc-1 12 54 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-dead-1 26 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-hlyd-1 18 52 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-glna-1 13 42 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-clpb-1 27 48 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sige-recj-1 28 34 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction