DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. DIP original experiment: DIP-216062X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. Only protein-protein interactions nicbe Nicotiana benthamiana molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. DIP original experiment: DIP-216059X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. Only protein-protein interactions nicbe Nicotiana benthamiana light scattering light scattering predetermined predetermined participant predetermined O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. DIP original experiment: DIP-216060X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined O'Keefe BR., Vojdani F., Buffa V., Shattock RJ., Montefiori DC., Bakke J., Mirsalis J., d'Andrea AL., Hume SD., Bratcher B., Saucedo CJ., McMahon JB., Pogue GP., Palmer KE. DIP original experiment: DIP-216061X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Scaleable manufacture of HIV-1 entry inhibitor griffithsin and validation of its safety and efficacy as a topical microbicide component. gp120 Envelope surface glycoprotein gp120 protein protein 9hiv1 Human immunodeficiency virus 1 grfin_grisq Griffithsin protein protein grisq Griffithsia sp. (strain Q66D336) SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDXIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY DIP protein P84801 original sequence version: 13 DIP protein P84801 original sequence version: 14 mint F89843AF6DE5049D grfin_grisq-2 2 6 unspecified role unspecified role unspecified role unspecified role nicbe Nicotiana benthamiana direct interaction direct interaction grfin_grisq-3 3 6 unspecified role unspecified role unspecified role unspecified role nicbe Nicotiana benthamiana direct interaction direct interaction gp120-grfin_grisq-1 4 6 unspecified role unspecified role prey prey nicbe Nicotiana benthamiana 5 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction gp120-grfin_grisq-2 1 6 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction