DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Metal-binding loop length and not sequence dictates structure. Metal-binding loop length and not sequence dictates structure. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Sato K., Li C., Salard I., Thompson AJ., Banfield MJ., Dennison C. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sato K., Li C., Salard I., Thompson AJ., Banfield MJ., Dennison C. DIP original experiment: DIP-134041X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Metal-binding loop length and not sequence dictates structure. azur_pseae Azurin azu PA4922 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MLRKLAAVSLLSLLSAPLLAAECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK 9C3881D7B6D64B67 mint 9C3881D7B6D64B67 az-1 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction