DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Desbien AL., Kappler JW., Marrack P. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Desbien AL., Kappler JW., Marrack P. DIP original experiment: DIP-260237X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Desbien AL., Kappler JW., Marrack P. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Desbien AL., Kappler JW., Marrack P. DIP original experiment: DIP-260235X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Desbien AL., Kappler JW., Marrack P. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Desbien AL., Kappler JW., Marrack P. DIP original experiment: DIP-260238X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Desbien AL., Kappler JW., Marrack P. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Desbien AL., Kappler JW., Marrack P. DIP original experiment: DIP-260239X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Desbien AL., Kappler JW., Marrack P. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Desbien AL., Kappler JW., Marrack P. DIP original experiment: DIP-260236X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Epstein-Barr virus Bcl-2 homolog, BHRF1, blocks apoptosis by binding to a limited amount of Bim. bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS DIP protein O08734 original sequence version: 116 DIP protein O08734 original sequence version: 66 DIP protein O08734 original sequence version: 114 DIP protein O08734 original sequence version: 129 49972D3CA21F4218 ear_ebvb9 Apoptosis regulator BHRF1 BHRF1 Nuclear antigen Early antigen protein R protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISRGRH DIP protein P03182 original sequence version: 91 8108BCB94F81DC8B b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918 original sequence version: 130 531C176E5F1AC9AA ear_ebvb9-bak1-1 4 6 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ear_ebvb9-bak1-2 2 8 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait P03182:p.Leu98Ala L98A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L98A'. Wed May 02 16:23:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu98ala' Tue Jun 30 19:38:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu98Ala' P03182:p.Gly99Ala G99A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G99A'. Wed May 02 17:12:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly99ala' Tue Jun 30 19:15:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly99Ala' P03182:p.Arg100Ala R100A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R100A'. Wed May 02 19:17:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg100ala' Tue Jun 30 18:30:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg100Ala' P03182:p.[Leu98Ala;Gly99Ala;Arg100Ala] L98A/G99A/R100A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'L98A/G99A/R100A'. Wed May 02 15:37:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu98ala,gly99ala,arg100ala' Tue Jun 30 18:16:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu98Ala;Gly99Ala;Arg100Ala]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association bcl2l11-ear_ebvb9-1 1 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association ear_ebvb9-bcl2l11-1 3 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association ear_ebvb9-bcl2l11-2 5 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P03182:p.Gly99Ala G99A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A This feature has been corrected as a result of our quality control procedures. The original label was 'G99A'. Wed May 02 17:26:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly99ala' Tue Jun 30 20:07:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly99Ala' mouse Mus musculus Mouse physical association physical association