DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of HIV-1 protease in complex with potent inhibitor KNI-272 determined by high-resolution X-ray and neutron crystallography. Structure of HIV-1 protease in complex with potent inhibitor KNI-272 determined by high-resolution X-ray and neutron crystallography. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Adachi M., Ohhara T., Kurihara K., Tamada T., Honjo E., Okazaki N., Arai S., Shoyama Y., Kimura K., Matsumura H., Sugiyama S., Adachi H., Takano K., Mori Y., Hidaka K., Kimura T., Hayashi Y., Kiso Y., Kuroki R. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Adachi M., Ohhara T., Kurihara K., Tamada T., Honjo E., Okazaki N., Arai S., Shoyama Y., Kimura K., Matsumura H., Sugiyama S., Adachi H., Takano K., Mori Y., Hidaka K., Kimura T., Hayashi Y., Kiso Y., Kuroki R. DIP original experiment: DIP-134011X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of HIV-1 protease in complex with potent inhibitor KNI-272 determined by high-resolution X-ray and neutron crystallography. Structure of HIV-1 protease in complex with potent inhibitor KNI-272 determined by high-resolution X-ray and neutron crystallography. Structure of HIV-1 protease in complex with potent inhibitor KNI-272 determined by high-resolution X-ray and neutron crystallography. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Adachi M., Ohhara T., Kurihara K., Tamada T., Honjo E., Okazaki N., Arai S., Shoyama Y., Kimura K., Matsumura H., Sugiyama S., Adachi H., Takano K., Mori Y., Hidaka K., Kimura T., Hayashi Y., Kiso Y., Kuroki R. Only protein-protein interactions ecolx Escherichia coli neutron diffraction neutron diffraction predetermined predetermined participant predetermined Adachi M., Ohhara T., Kurihara K., Tamada T., Honjo E., Okazaki N., Arai S., Shoyama Y., Kimura K., Matsumura H., Sugiyama S., Adachi H., Takano K., Mori Y., Hidaka K., Kimura T., Hayashi Y., Kiso Y., Kuroki R. DIP original experiment: DIP-134012X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of HIV-1 protease in complex with potent inhibitor KNI-272 determined by high-resolution X-ray and neutron crystallography. q7ssi0_9hiv1 Protease Retropepsin pol protein protein 9hiv1 Human immunodeficiency virus 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGSTLNF DIP protein Q7SSI0 original sequence version: 41 pol-3 1 3 unspecified role unspecified role unspecified role unspecified role Region 1-99 Region 1-99 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pol-4 2 3 unspecified role unspecified role unspecified role unspecified role Region 1-99 Region 1-99 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction