DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions chlre Chlamydomonas reinhardtii Chlamydomonas smithii pull down pull down western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132594X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132591X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132592X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132596X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132595X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132590X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. Analysis of the chloroplast protein kinase Stt7 during state transitions. PLoS biology 2009 imex curation Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. Only protein-protein interactions chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lemeille S., Willig A., Depège-Fargeix N., Delessert C., Bassi R., Rochaix JD. DIP original experiment: DIP-132593X PLoS biology 2009 IMEx Analysis of the chloroplast protein kinase Stt7 during state transitions. stt7_chlre Serine/threonine-protein kinase stt7, chloroplastic STT7 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MALAQRQVSCRIERSTGASTSQPVGSCLLVQRRPGQRRGVPARATPEFIDALSALVPNLPLEQIAAPCQVMKCGDIVYRSTLDPSLYNEAGFDEKTVALLAPVLAYLFLPPGVLPGAIDYYIRAPLKRKQTKAIDKNDIVLGKRLGTGGFGTVFKGELKEEGGVKTSIIIKKAKEFGEAEVWMNERMSRVAGHHVAEFVTAFDESLNVPLPAAAGKRAAPVQPTSPLDANSIWLVWVYEGDNTLSSLMERREWPYNLEPLLFGRELRAPRGPVRELVTIKEAFRQLVQAVAACHSVGIVHRDIKPANCIVSERDKKIKLIDLGAAADLRIGINYVPNEYLLDPRYAPPQQYIMSTQTPKPPPKPVAAFLSPILWTMEKPDRFDMYSCGITLLQMVFGHLRNDNALIAFNKRLQELKWDLPAWRREEEAKLPSAKGALAESLEAGFEALDADGGAGWDLLMRLLAYKPTDRPSAAAVLAHPWLTSAPGRTASLQHSLSGSFEATVSTAAAATSTALTAAGKSLGQAAKDAGLASMEEAILKVNQGALTEAQLMEELGLQEPAPVAPREGSQTIAWWQERQNELKARLVERREAMSESDPYGAAPSAMQVGSAINNARGGKGAKPTTPVKPTGPMAAAGAAAAAAAAAARVEAKVKVPNILGVKKPASGGGSNGRANGNGNGKAAPAKAANGNGSGNGNTNGNGNGAKQQLFGGLLGRKQQPVEEVQEEPEEEVEPEQETASKKERAFNLLGVFRR DIP protein Q84V18 original sequence version: 39 q9fek6_chlre Chlorophyll a-b binding protein, chloroplastic lhcb5 LHCB5 CHLREDRAFT_184397 CHLRE_16g673650v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MQIQALFKKTGASAPAKKGTASTKVVKPSKAGGKATRGWLGGQGGAADLDKWYGPDRKLFLPSGLYDRSEIPEYLNGELAGDYGYDPLGLGKDPETVAKYRENELLHARWAMLAAAGILIPEGLQANGANIKGGTWFETGAEMLNGGTLNYFAVPWGIVSNPLPLFAVIAVEVGLMGAVEFYRRNGTGPAGYSPGIGKFDSSVFDGLDPLYPGGPFDPLGLADDPEVLQELKVKEIKNGRLAMVSVLGFAVQSYVTGEGPYANWTKHVADPFGYNLLTVLGAEERTPTL DIP protein Q9FEK6 original sequence version: 75 DIP protein Q9FEK6 original sequence version: 41 q9zsj4_chlre Chlorophyll a-b binding protein, chloroplastic Lhcb3 LHCBM5 CHLREDRAFT_184775 CHLRE_03g156900v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MMLSRTVVNVQAKLTKKGGAPKKAAPASAQKKTIREKAGWWSNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKNGTPIVEPVWFKAGAQIFAEGGLDYLGNPGLVHAQSILATLAVQVILMGAIEGYRVNGGPAGEGLDKLHPGGQFFDPLGLAEDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLANLDEHLASPFTSNAFTYAQKFTPQ DIP protein Q9ZSJ4 original sequence version: 44 a8j9y1_chlre PETC CHLREDRAFT_193296 CHLRE_11g467689v5 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAMLSSRRVAAPAKASAIRRSRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTLALGYGAFFVPPSSGGGGGGQAAKDALGNDIKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAESGLVTFSTWTETDFRTGLEPWWA DIP protein A8J9Y1 original sequence version: 22 psaa_chlre Photosystem I P700 chlorophyll a apoprotein A1 psaA ps1a1 PSI-A PsaA protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG DIP protein P12154 original sequence version: 118 DIP protein P12154 original sequence version: 94 DIP protein P12154 original sequence version: 93 4D8876D1094BDCD3 cyf_chlre Cytochrome f petA protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MSNQVFTTLRAATLAVILGMAGGLAVSPAQAYPVFAQQNYANPREANGRIVCANCHLAQKAVEIEVPQAVLPDTVFEAVIELPYDKQVKQVLANGKKGDLNVGMVLILPEGFELAPPDRVPAEIKEKVGNLYYQPYSPEQKNILVVGPVPGKKYSEMVVPILSPDPAKNKNVSYLKYPIYFGGNRGRGQVYPDGKKSNNTIYNASAAGKIVAITALSEKKGGFEVSIEKANGEVVVDKIPAGPDLIVKEGQTVQADQPLTNNPNVGGFGQAETEIVLQNPARIQGLLVFFSFVLLTQVLLVLKKKQFEKVQLAEMNF DIP protein P23577 original sequence version: 92 DIP protein P23577 original sequence version: 91 1DC74E50552B7A53 cb29_chlre Chlorophyll a-b binding protein CP29 Lhcb4 Lhcbm4 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MVFKFPTPPGTQKKAGTTATKPAPKATTKKVATSTGTRSGGVGYRKYQGDALWLPNTTRPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKHARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNGKGL DIP protein Q93WD2 original sequence version: 79 DIP protein Q93WD2 original sequence version: 51 DIP protein Q93WD2 original sequence version: 50 stt7-lhcb3-1 6 11 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 10 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 9 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 14 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 12 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii 13 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association psaa-stt7-1 3 12 unspecified role unspecified role bait bait chlre Chlamydomonas reinhardtii Chlamydomonas smithii 8 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii physical association physical association stt7-lhcb3-2 2 11 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 10 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 9 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 12 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii 13 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association stt7-peta-1 4 12 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 11 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 8 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii 13 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association stt7-petc-1 5 11 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association peta-stt7-1 7 8 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii 13 unspecified role unspecified role bait bait chlre Chlamydomonas reinhardtii Chlamydomonas smithii physical association physical association peta-petc-1 1 11 unspecified role unspecified role prey prey chlre Chlamydomonas reinhardtii Chlamydomonas smithii 8 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlre Chlamydomonas reinhardtii Chlamydomonas smithii association association