DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of human CDK4 in complex with a D-type cyclin. Crystal structure of human CDK4 in complex with a D-type cyclin. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. DIP original experiment: DIP-133813X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of human CDK4 in complex with a D-type cyclin. Crystal structure of human CDK4 in complex with a D-type cyclin. Crystal structure of human CDK4 in complex with a D-type cyclin. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Day PJ., Cleasby A., Tickle IJ., O'Reilly M., Coyle JE., Holding FP., McMenamin RL., Yon J., Chopra R., Lengauer C., Jhoti H. DIP original experiment: DIP-133814X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Crystal structure of human CDK4 in complex with a D-type cyclin. cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE DIP protein P11802 original sequence version: 177 DIP protein P11802 original sequence version: 135 DIP protein P11802 original sequence version: 136 DIP protein P11802 original sequence version: 200 DIP protein P11802 original sequence version: 86 0916A0C07403A33A ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A ccnd1-cdk4-18 1 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role unspecified role unspecified role Region 15-271 Region 15-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ccnd1-cdk4-19 2 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role unspecified role unspecified role Region 15-271 Region 15-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction