DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216043X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216044X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens pull down pull down western blot western blot Immuno blot Immuno blot Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216045X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Sigma factor mimicry involved in regulation of general stress response. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216046X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. c5aw20_metea nepR MexAM1_META1p3109 protein protein metea Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) MWRQGDLERMNENEPAGAFPSGDRPTRGRGDNGLNDQTQRRIGSHLRTLYDSVVQQPIPDRFRDLIARLEDEPANPDDPASV DIP protein C5AW20 original sequence version: 5 c5asq2_metea RNA polymerase sigma factor ecfG1 MexAM1_META1p4906 protein protein metea Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) MRNDTEATLDRPAMTDGRPKLSDSIRSHLGDHLRSVYDTLGAGEDTPSRFSELIGKLEAALKAQGERIDPEFRNGLLSAVPSLRAFALSLTSNPARSDDLVQDTLLKGWQHRARFQPGTNLNAWLFTILRNIFYSDHRKRVREVEDQDGSYAARLATAPHQGDRLDVEDLQTALAKLPPDQREALVLVGAEGVSYEEAATIMGCKVGTVKSRVSRARGRLAELLGYDEEDLSSDRLIQSAMPDA DIP protein C5ASQ2 original sequence version: 10 phyr_metea Phyllosphere-induced regulator PhyR phyR MexAM1_META1p3110 protein protein metea Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) MSTAQLVVQHLPYLRRYARALTGSQVAGDAYVAATLETLVNEPETLGRSTNVKADLFRVFTRIWNSLSVNGHSDQVQHDLPAEVRLGQITPLPRQAFLLSCLEGFSEEDAGVILDVDVSKVRDLVDEAGRELAADMATEILIIEDEPLIAMDLEALVEGLGHNVIGVARTRTEAVKIASESKRPGLILADIQLADGSSGLDAVNDLLKTFEVPVIFITAYPERFLTGERPEPAFLIAKPFQPANVSAVISQALFFQQSARRREAHNA DIP protein Q0PEV3 original sequence version: 25 nepr-phyr-1 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Q0PEV3:p.Asp190Ala D190A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D190A'. Wed May 02 20:08:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp190ala' Tue Jun 30 20:05:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp190Ala' ecolx Escherichia coli direct interaction direct interaction ecfg1-nepr-1 2 6 unspecified role unspecified role unspecified role unspecified role Region 65-244 Region 65-244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nepr-1 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nepr-ecfg1-1 3 6 unspecified role unspecified role prey prey metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens 7 unspecified role unspecified role prey prey metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens association association