DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. DIP original experiment: DIP-133756X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. DIP original experiment: DIP-133752X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. DIP original experiment: DIP-133754X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. DIP original experiment: DIP-133753X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Raffa GD., Siriaco G., Cugusi S., Ciapponi L., Cenci G., Wojcik E., Gatti M. DIP original experiment: DIP-133755X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The Drosophila modigliani (moi) gene encodes a HOAP-interacting protein required for telomere protection. cav_drome Telomere-binding protein cav cav anon fe 1G5 anon1G5 Anonymous fast evolving 1G5 HP1/ORC-associated protein Hoap IG5 Protein caravaggio CG6219 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLLLLCVNMSGTQMSAFLRKYLADEDKKIRAQFKESDPNNKLILWMHEKTRITEEDLARPYTEDEVKELCLRTKVKVDMTAWNCLWEAKKRFEAKGRFVNKSERFINRMYMKAVRRKMVQPYPEEFVAQRREIVAAETKKQNISRLDRWQKKKSQNLSAPESSPDAHASSNDAVQSHEDQANTNLSSLSQMNFQVEAMAPPGVSSSDLSGIGDDEDEQQQSGFQDENINRPETEINENSVRCDPINLGRMRTGCINSQANNSFRNTESDPDYYMFGTQLSTLVRPTSTQEPDDQVNCPETEMNESWVRCDQINSESLSIGPSIDSEGTITFQNTESEPIDVTSIA This sequence has been withdrawn from Uniprot. FB325B88570FCF0E FB325B88570FCF0E b7z0l8_drome DTLu Dmel\CG42350 Dtl uORF Moi l(3)CB02140 l(3)S096713 tlu uORF Dmel_CG42350 13 0967 moi CG42350 CG31241 DTL protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLVPEASTSRAPKYCYFFKTLLVEELELETSYHNLHYGQCALIGRLAFKANQYRLENVRVKCLPKKYSLGEGTVSLLILGLTHDKVVENRVSTGRYCIVRGEVVLHNVQHPKGAKLTAGGVYDKINSLSNDPLAQKQYLSALLATYRPAIDLWYIQVIDRAEDLLTRRLEMRSLIEK DIP protein B7Z0L8 original sequence version: 11 hp1_drome Heterochromatin protein 1 Su(var)205 HP1 CG8409 Non-histone chromosomal protein C1A9 antigen protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYSDNED DIP protein P05205 original sequence version: 93 DIP protein P05205 original sequence version: 157 DIP protein P05205 original sequence version: 117 6A5B204C487526B7 su(var)205-moi-1 3 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction moi-hoap-1 2 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association su(var)205-moi-2 1 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association su(var)205-hoap-1 5 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly association association hoap-moi-1 4 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction