DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Basu S., Liu Q., Qiu Y., Dong F. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Basu S., Liu Q., Qiu Y., Dong F. DIP original experiment: DIP-133690X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Basu S., Liu Q., Qiu Y., Dong F. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Basu S., Liu Q., Qiu Y., Dong F. DIP original experiment: DIP-133691X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Basu S., Liu Q., Qiu Y., Dong F. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Basu S., Liu Q., Qiu Y., Dong F. DIP original experiment: DIP-133694X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Basu S., Liu Q., Qiu Y., Dong F. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Basu S., Liu Q., Qiu Y., Dong F. DIP original experiment: DIP-133695X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Basu S., Liu Q., Qiu Y., Dong F. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Basu S., Liu Q., Qiu Y., Dong F. DIP original experiment: DIP-133693X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Basu S., Liu Q., Qiu Y., Dong F. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Basu S., Liu Q., Qiu Y., Dong F. DIP original experiment: DIP-133692X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Gfi-1 represses CDKN2B encoding p15INK4B through interaction with Miz-1. gfi1_rat Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein rat Rattus norvegicus (Rat) Rat MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPVPGRADGGAVSAGESKMEPRERLSPESQLTEAPDRASASPNSCEGSVCDPSSEFEDYWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGAESGRPAARYGSEQAAGGAGAGQPGSCGAASGATSAGGLGLYGDFAPAAAGLFERPSTAAGRLYQDRGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q07120 original sequence version: 75 FC39B6100D684D14 q13105-1 Zinc finger and BTB domain-containing protein 17 ZBTB17 MIZ1 ZNF151 ZNF60 Myc-interacting zinc finger protein 1 Zinc finger protein 151 Zinc finger protein 60 protein protein human Homo sapiens Human MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPAE DIP protein Q13105-1 original sequence version: 110 myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q99684 original sequence version: 93 DIP protein Q99684 original sequence version: 94 740A466F72C5FC72 zbt17_mouse Zinc finger and BTB domain-containing protein 17 Zbtb17 Zfp100 Znf151 LP-1 Polyomavirus late initiator promoter-binding protein Zinc finger protein 100 Zinc finger protein 151 Zinc finger protein Z13 protein protein mouse Mus musculus Mouse MDFPQHSQRVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDIVTACHTLKSLAEPSSTTGESADASAVEGGDKRAKDEKAAATMLSRLDQARGSSSTGPGRELKEERGGQAESASSGAEQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEMEVEPASKGEDGQEEEGAGPATVKEEGMHLDNGEPPEENEESAGTDSGQELGMEGQNLRSGTYGDRTESKAYGSIIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCGDCGKLFTTSGNLKRHQLVHSGQKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCTHCQRQFADPGALQRHVRIHTGEKPCQCVICGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPAGQMLQAGELVFRPRDGTEGQPTLAESPPTAPDCLPPAE DIP protein Q60821 original sequence version: 89 54CF6CF0D2C60303 zbt17_human Zinc finger and BTB domain-containing protein 17 ZBTB17 MIZ1 Zinc finger protein 60 Zinc finger protein 151 Myc-interacting zinc finger protein 1 ZNF151 ZNF60 protein protein human Homo sapiens Human MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPAE DIP protein Q13105 original sequence version: 110 C159D177C8A2D4A3 gfi1-zbtb17-1 1 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction gfi1-zbtb17-2 6 11 unspecified role unspecified role prey prey Region 297-628 Region 297-628 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association zbtb17-gfi1-1 2 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 329-803 Region 329-803 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gfi1-myc-1 4 11 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association zbtb17-gfi1-2 5 10 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association gfi1-zbtb17-3 3 7 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association