DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nature structural & molecular biology 2009 imex curation Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132934X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nature structural & molecular biology 2009 imex curation Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132939X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nature structural & molecular biology 2009 imex curation Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132938X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nature structural & molecular biology 2009 imex curation Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132937X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nature structural & molecular biology 2009 imex curation Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132935X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. Nature structural & molecular biology 2009 imex curation Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Quistgaard EM., Madsen P., Grøftehauge MK., Nissen P., Petersen CM., Thirup SS. DIP original experiment: DIP-132936X Nature structural & molecular biology 2009 IMEx Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain. ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA DIP protein P01138 original sequence version: 170 DIP protein P01138 original sequence version: 144 DIP protein P01138 original sequence version: 121 DIP protein P01138 original sequence version: 172 619DFC65EB3BD671 amrp_human Alpha-2-macroglobulin receptor-associated protein Low density lipoprotein receptor-related protein-associated protein 1 LRPAP1 A2MRAP protein protein human Homo sapiens Human MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL DIP protein P30533 original sequence version: 105 DIP protein P30533 original sequence version: 103 D56A7DA754125CFA nt Neurotensin peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ELYENKPRRPYIL bdnf_human Brain-derived neurotrophic factor Abrineurin BDNF protein protein human Homo sapiens Human MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR DIP protein P23560 original sequence version: 121 0A60488254722A99 sort_human Sortilin SORT1 Neurotensin receptor 3 Glycoprotein 95 100 kDa NT receptor protein protein human Homo sapiens Human MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE DIP protein Q99523 original sequence version: 97 DIP protein Q99523-1 original sequence version: 127 91F96A3035A4B43A nt-sort1-1 1 9 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction sort1-bdnf-1 4 10 unspecified role unspecified role prey prey region 19-128 region 19-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction nt-sort1-2 5 11 unspecified role unspecified role unspecified role unspecified role Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 9 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction sort1-lrpap1-1 2 8 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction sort1-sort1-1 3 11 unspecified role unspecified role prey prey Region 34-77 Region 34-77 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q99523:p.Ser316Glu S316E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E This feature has been corrected as a result of our quality control procedures. The original label was 'S316E'. Wed May 02 19:47:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser316glu' Tue Jun 30 20:13:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser316Glu' crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction sort1-ngf-2 6 7 unspecified role unspecified role prey prey Region 19-121 Region 19-121 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 1-758 Region 1-758 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction