DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Wnt signaling targets ETO coactivation domain of TAF4/TFIID in vivo. Wnt signaling targets ETO coactivation domain of TAF4/TFIID in vivo. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Wright KJ., Tjian R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wright KJ., Tjian R. DIP original experiment: DIP-133612X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Wnt signaling targets ETO coactivation domain of TAF4/TFIID in vivo. Wnt signaling targets ETO coactivation domain of TAF4/TFIID in vivo. Wnt signaling targets ETO coactivation domain of TAF4/TFIID in vivo. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Wright KJ., Tjian R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wright KJ., Tjian R. DIP original experiment: DIP-133611X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Wnt signaling targets ETO coactivation domain of TAF4/TFIID in vivo. taf4_drome Transcription initiation factor TFIID subunit 4 Transcription initiation factor TFIID 110 kDa subunit 110 kDa TBP-associated factor Taf4 TAF110 CG5444 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQQVHHVQQQQQSQQQQQQQQQTQSAGQPLLNSMLPAGVVVGMRQQAPSQQQQKNVPTNPLSRVVINSHMAGVRPQSPSITLSTLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNTSNNSNTTSTTNHPTTTQIRLQTVPAAASMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQITQIQTIPAQQSQQQQVNNVSSAGGTATAVSSTTAATTTQQGNTKEKCRKFLANLIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELVIEGIKPPPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRPTIGHTTISKQPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSVQIRATTRPPNSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLNSASTTTLPIPSLPTVHLPPEALRAREQMQNSLNHNSNHFDAKLVEIKAPSLHPPHMERINASLTPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSFFQQSSMSSMYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK DIP protein P47825 original sequence version: 137 DIP protein P47825-1 original sequence version: 103 DIP protein P47825 original sequence version: 104 DIP protein P47825-1 original sequence version: 140 27E6852859872767 pygo_drome Protein pygopus pygo gam CG11518 Protein gammy legs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTHNLGMAPYRLPGPAGGLCPPDFKPPPPTDIISAPSNPKKRRKTSSAANSAAAVAAAAAAAAAANSMQQQQAPPTPQDLLPPPPMGGFGDTIIASNPFDDSPQVSAMSSSAAAAMAAMNQMGGGPGGGHFGGGGPGGHPHWEDRMGMGGGPPPPPHMHPHMHPHHPGGPMGHPHGPHPHMGGPPPMRGMSPMHPHQMGPGPGVGLPPHMNHGRPGGPGGPGGPVPMGSPMGGIAGMGGMSPMGGMGGPSISPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGNPIGSPLGPPSGPGPGNPGNTGGPQQQQQQPPQPPMNNGQMGPPPLHSPLGNGPTGHGSHMPGGPIPGPGPGPGGLVGPGGISPAHGNNPGGSGNNMLGGNPGGGNSNNNGSNTSNASNNNQNPHLSPAAGRLGVPTSMQSNGPSVSSVASSSVPSPATPTLTPTSTATSMSTSVPTSSPAPPAMSPHHSLNSAGPSPGMPNSGPSPLQSPAGPNGPNNNNSNNNNGPMMGQMIPNAVPMQHQQHMGGGPPGHGPGPMPGMGMNQMLPPQQPSHLGPPHPNMMNHPHHPHHHPGGPPPHMMGGPGMHGGPAGMPPHMGGGPNPHMMGGPHGNAGPHMGHGHMGGVPGPGPGPGGMNGPPHPHMSPHHGHPHHHHNPMGGPGPNMFGGGGGGPMGPGGPMGNMGPMGGGPMGGPMGVGPKPMTMGGGKMYPPGQPMVFNPQNPNAPPIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVSSKHIPMVKFKC DIP protein Q9V9W8 original sequence version: 59 DIP protein Q9V9W8 original sequence version: 78 DIP protein Q9V9W8 original sequence version: 107 369FD5A5D34BC136 taf4-pygo-1 2 4 unspecified role unspecified role prey prey Region 1-200 Region 1-200 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 3 unspecified role unspecified role bait bait Region 301-365 Region 301-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association taf4-pygo-2 1 4 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-200 Region 1-200 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role bait bait Region 301-365 Region 301-365 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association