DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu High-resolution structure of the open NaK channel. High-resolution structure of the open NaK channel. Nature structural & molecular biology 2009 imex curation Alam A., Jiang Y. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Alam A., Jiang Y. DIP original experiment: DIP-132933X Nature structural & molecular biology 2009 IMEx High-resolution structure of the open NaK channel. High-resolution structure of the open NaK channel. High-resolution structure of the open NaK channel. Nature structural & molecular biology 2009 imex curation Alam A., Jiang Y. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Alam A., Jiang Y. DIP original experiment: DIP-132932X Nature structural & molecular biology 2009 IMEx High-resolution structure of the open NaK channel. q81hw2_baccr BC_0669 protein protein baccr Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKE DIP protein Q81HW2 original sequence version: 68 DIP protein Q81HW2 original sequence version: 32 DIP protein Q81HW2 original sequence version: 42 DIP protein Q81HW2 original sequence version: 57 q81hw2_baccr-5 2 3 unspecified role unspecified role unspecified role unspecified role Region 20-114 Region 20-114 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q81hw2_baccr-6 1 3 unspecified role unspecified role unspecified role unspecified role Region 20-114 Region 20-114 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction