DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A dual-signal regulatory circuit activates transcription of a set of divergent operons in Salmonella typhimurium. A dual-signal regulatory circuit activates transcription of a set of divergent operons in Salmonella typhimurium. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhao G., Weatherspoon N., Kong W., Curtiss R., Shi Y. Only protein-protein interactions Salmonella typhimurium Salmonella typhimurium crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Zhao G., Weatherspoon N., Kong W., Curtiss R., Shi Y. DIP original experiment: DIP-133601X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A dual-signal regulatory circuit activates transcription of a set of divergent operons in Salmonella typhimurium. slya_salty Transcriptional regulator SlyA slyA Cytolysin SlyA Salmolysin STM1444 protein protein salty Salmonella typhimurium MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKADALIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSHD 2D37EB004F2D7439 slya-1 1 2 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Salmonella typhimurium Salmonella typhimurium direct interaction direct interaction