DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132186X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132187X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132185X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Pei XY., Titman CM., Frank RA., Leeper FJ., Luisi BF. DIP original experiment: DIP-132188X Structure (London, England : 1993) 2008 IMEx Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multienzyme complex. odpa_geose Pyruvate dehydrogenase E1 component subunit alpha pdhA protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MGVKTFQFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDDPTRYRSKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMFEELPFNLKEQYEIYKEKESK DIP protein P21873 original sequence version: 69 DIP protein P21873 original sequence version: 56 DIP protein P21873 original sequence version: 68 DBF43982C0E1926D odpb_geose Pyruvate dehydrogenase E1 component subunit beta pdhB protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MAQMTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGLQAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQFFGFVYEVMDSICGQMARIRYRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEHLKLYRSFRQEVPEGEYTIPIGKADIKREGKDITIIAYGAMVHESLKAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAEINERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF DIP protein P21874 original sequence version: 73 DIP protein P21874 original sequence version: 60 DIP protein P21874 original sequence version: 72 AD1F2D4F82D652AC odp2_geose Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex pdhC E2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLMEA DIP protein P11961 original sequence version: 92 DIP protein P11961 original sequence version: 77 DIP protein P11961 original sequence version: 91 DIP protein P11961 original sequence version: 114 2600CD150261ACB0 pdha-pdhb-8 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pdha-pdhb-9 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-171 Region 1-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association pdha-pdhb-10 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pdha-pdhb-11 2 7 unspecified role unspecified role unspecified role unspecified role Region 123-171 Region 123-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction