DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Su ZZ., Lee SG., Emdad L., Lebdeva IV., Gupta P., Valerie K., Sarkar D., Fisher PB. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su ZZ., Lee SG., Emdad L., Lebdeva IV., Gupta P., Valerie K., Sarkar D., Fisher PB. DIP original experiment: DIP-133591X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Su ZZ., Lee SG., Emdad L., Lebdeva IV., Gupta P., Valerie K., Sarkar D., Fisher PB. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Su ZZ., Lee SG., Emdad L., Lebdeva IV., Gupta P., Valerie K., Sarkar D., Fisher PB. DIP original experiment: DIP-133590X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Su ZZ., Lee SG., Emdad L., Lebdeva IV., Gupta P., Valerie K., Sarkar D., Fisher PB. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Su ZZ., Lee SG., Emdad L., Lebdeva IV., Gupta P., Valerie K., Sarkar D., Fisher PB. DIP original experiment: DIP-133592X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cloning and characterization of SARI (suppressor of AP-1, regulated by IFN). q8n1l9-1 Basic leucine zipper transcriptional factor ATF-like 2 BATF2 Suppressor of AP-1 regulated by IFN protein protein human Homo sapiens Human MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF DIP protein Q8N1L9-1 original sequence version: 56 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 batf2-jun-1 2 5 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association jun-batf2-1 1 5 unspecified role unspecified role bait bait human Homo sapiens Human 4 unspecified role unspecified role prey prey Q8N1L9-1:p.Leu59Pro L59P mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L59P'. Wed May 02 19:42:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu59pro' Tue Jun 30 17:30:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu59Pro' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association batf2-jun-2 3 5 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait Q8N1L9-1:p.Leu59Pro L59P mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P This feature has been corrected as a result of our quality control procedures. The original label was 'L59P'. Wed May 02 16:25:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu59pro' Tue Jun 30 17:54:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu59Pro' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association