DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. DIP original experiment: DIP-133570X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chipuk JE., Fisher JC., Dillon CP., Kriwacki RW., Kuwana T., Green DR. DIP original experiment: DIP-133571X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins. mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF bcl2-bid-2 1 5 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association mcl1-bid-1 2 5 unspecified role unspecified role prey prey human Homo sapiens Human 3 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association