DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260509X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260512X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260521X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260514X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260510X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260507X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260516X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260508X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260518X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260513X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260515X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260511X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260517X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260522X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260519X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pekarsky Y., Palamarchuk A., Maximov V., Efanov A., Nazaryan N., Santanam U., Rassenti L., Kipps T., Croce CM. DIP original experiment: DIP-260520X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Tcl1 functions as a transcriptional regulator and is directly involved in the pathogenesis of CLL. fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 tcl1a_human T-cell leukemia/lymphoma protein 1A Protein p14 TCL1 Oncogene TCL-1 TCL1A TCL1 protein protein human Homo sapiens Human MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD DIP protein P56279 original sequence version: 127 90D55ABC97C36D04 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF DIP protein P17275 original sequence version: 151 DIP protein P17275 original sequence version: 118 DIP protein P17275 original sequence version: 143 DF8CD1CD4409C6BE ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB tcl1a-jun-1 3 18 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ep300-tcl1a-1 6 18 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tcl1a-jun-2 13 18 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tcl1a-fos-1 7 18 unspecified role unspecified role bait bait human Homo sapiens Human 17 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association jun-tcl1a-1 2 18 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 19 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association fos-tcl1a-1 8 18 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tcl1a-jun-3 14 18 unspecified role unspecified role bait bait human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association fos-tcl1a-2 9 18 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association jun-tcl1a-2 10 18 unspecified role unspecified role prey prey human Homo sapiens Human 19 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association jun-tcl1a-3 1 18 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 19 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tcl1a-ep300-1 4 18 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tcl1a-fos-2 15 18 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tcl1a-ep300-2 11 18 unspecified role unspecified role bait bait human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association junb-tcl1a-1 5 18 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association tcl1a-junb-1 16 18 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 20 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ep300-tcl1a-2 12 18 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association