DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu S layer protein A of Lactobacillus acidophilus NCFM regulates immature dendritic cell and T cell functions. S layer protein A of Lactobacillus acidophilus NCFM regulates immature dendritic cell and T cell functions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Konstantinov SR., Smidt H., de Vos WM., Bruijns SC., Singh SK., Valence F., Molle D., Lortal S., Altermann E., Klaenhammer TR., van Kooyk Y. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Konstantinov SR., Smidt H., de Vos WM., Bruijns SC., Singh SK., Valence F., Molle D., Lortal S., Altermann E., Klaenhammer TR., van Kooyk Y. DIP original experiment: DIP-260506X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx S layer protein A of Lactobacillus acidophilus NCFM regulates immature dendritic cell and T cell functions. cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 slap_lacac S-layer protein slpA Surface layer protein LBA0169 protein protein lacac Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) MKKNLRIVSAAAAALLAVAPVAASAVSTVSAATTINASSSAINTNTNAKYDVDVTPSVSAVAANTANNTPAIAGNLTGTISASYNGKTYTANLKADTENATITAAGSTTAVKPAELAAGVAYTVTVNDVSFNFGSENAGKTVTLGSANSNVKFTGTNSDNQTETNVSTLKVKLDQNGVASLTNVSIANVYAINTTDNSNVNFYDVTSGATVTNGAVSVNADNQGQVNVANVVAAINSKYFAAQYADKKLNTRTANTEDAIKAALKDQKIDVNSVGYFKAPHTFTVNVKATSNTNGKSATLPVVVTVPNVAEPTVASVSKRIMHNAYYYDKDAKRVGTDSVKRYNSVSVLPNTTTINGKTYYQVVENGKAVDKYINAANIDGTKRTLKHNAYVYASSKKRANKVVLKKGEVVTTYGASYTFKNGQKYYKIGDNTDKTYVKVANFR DIP protein P35829 original sequence version: 72 slpa-cd209-1 1 3 unspecified role unspecified role bait bait lacac Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) 2 unspecified role unspecified role prey prey Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human direct interaction direct interaction