DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Complexin II plays a positive role in Ca2+-triggered exocytosis by facilitating vesicle priming. Complexin II plays a positive role in Ca2+-triggered exocytosis by facilitating vesicle priming. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Cai H., Reim K., Varoqueaux F., Tapechum S., Hill K., Sørensen JB., Brose N., Chow RH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cai H., Reim K., Varoqueaux F., Tapechum S., Hill K., Sørensen JB., Brose N., Chow RH. DIP original experiment: DIP-133519X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Complexin II plays a positive role in Ca2+-triggered exocytosis by facilitating vesicle priming. snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A cplx2_rat Complexin-2 Cplx2 Complexin II Synaphin-1 protein protein rat Rattus norvegicus (Rat) Rat MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK DIP protein P84087 original sequence version: 50 cplx2-snap25-1 1 4 unspecified role unspecified role bait bait P84087:p.Arg59His R59H mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain R H This feature has been corrected as a result of our quality control procedures. The original label was 'R59H'. Wed May 02 15:30:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg59his' Tue Jun 30 17:13:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg59His' P84087:p.Arg63Ala R63A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R63A'. Wed May 02 16:24:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg63ala' Tue Jun 30 17:24:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg63Ala' P84087:p.[Lys69Ala;Tyr70Ala] K69A/Y70A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K69A/Y70A'. Wed May 02 18:59:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys69ala,tyr70ala' Tue Jun 30 17:26:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys69Ala;Tyr70Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 3 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 2 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association