DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Porter SL., Roberts MA., Manning CS., Armitage JP. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Porter SL., Roberts MA., Manning CS., Armitage JP. DIP original experiment: DIP-133510X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Porter SL., Roberts MA., Manning CS., Armitage JP. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Porter SL., Roberts MA., Manning CS., Armitage JP. DIP original experiment: DIP-133509X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Porter SL., Roberts MA., Manning CS., Armitage JP. Only protein-protein interactions in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Porter SL., Roberts MA., Manning CS., Armitage JP. DIP original experiment: DIP-133506X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Porter SL., Roberts MA., Manning CS., Armitage JP. Only protein-protein interactions in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Porter SL., Roberts MA., Manning CS., Armitage JP. DIP original experiment: DIP-133507X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. A bifunctional kinase-phosphatase in bacterial chemotaxis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Porter SL., Roberts MA., Manning CS., Armitage JP. Only protein-protein interactions in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Porter SL., Roberts MA., Manning CS., Armitage JP. DIP original experiment: DIP-133508X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A bifunctional kinase-phosphatase in bacterial chemotaxis. q8kls7_cersp Histidine kinase cheA4 protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MSAPVEAGPDGGLLRVSSEKIGRLMDLVGELSLSVAETVHSPDLEGLELPAFDGAVHRLRMIVREVQDAATELRLVPVEEVFKRLRRMVRELERQTGKKIEMVFEGAETAIDKLVADQLYDPLLHVVRNSADHGLEPPEERRAAGKPETGRIVLAAAQAGSEVRISVADDGRGLSRPKILKRARERGLFGPDEEPEPATLWKVIFEPGFSTAEAVTNLSGRGVGMDVLNATMTALRGRIGVDSRDGQGSEVSLHIPVSLAFLDCIILRLGARLYALPIDAVSEIVQPKPCDLMGVGAAGGSEMLRLRGHWIPVCRLERFYGEAPSAVPPPAGQVLAVVSTATGLIALPVDEVLDRQQVVMKPLTGRLAQVRASWGCALLGTGEVALVLDGNRLAAGGAA DIP protein Q8KLS7 original sequence version: 48 DIP protein Q8KLS7 original sequence version: 46 q53134_cersp cheY cheY1 protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MPLTVLAIDDSRTIRELLREALVQAGFEVHLAIDGLDGLEKLEAAKPHAVITDINMPRMDGFGFIRAVREQPQHSALPIIVLTTESAAELKAKAREAGATAWIVKPFDEAKLVSALRRVAVA DIP protein Q53134 original sequence version: 53 DIP protein Q53134 original sequence version: 52 q8kls0_cersp cheA3 protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MSDAFDEMDEIWALYADDGAQALDAMEASLLALQAGEDAAAHVGPLFRAVHTFKGNSRVLGLSVVESRAHLCEDLIGLVRDAGVPMDGEIVEILLFASDTLRAMLEETAASRADVEGTGSEALMDQLRSKIARCSGAGAATAEVDAATAEERAATAEERAAATEAGAAPTETGAAATSAAEPSEAWGGSPETGAPAAAAEVLPVAGKAFPSVADILGLLDDSALPDTGEAAEVPLEAGGRPAGEGHAPAGPPPEAGPAEAPVPPAAEPARPAARLADDPVYRAIFRDMATAALTRFRAQIDAFATDPGATAQGARAEADGLCHAARQMGLDDWEAALAAFLSDSQGPERLAALVLELEALGDEPAPTPQVEEKPFFAAIAGPLAEIGRLGLRLVTGERPGPAERAAAADPLGQAALAQGYVRVAEAAQALAAAEGAEPFGTARLRLYEELAAVEALMPEAAAAAGVSPVGLLRRLCAAEAAETLAALDATLNAFRSAPLAETFGRFERLMRCVHHACAHHALDAAAQLAMSLVDLFGRAEAKGAVPDAMLVHIARGFIETIELAFEALAQGETPAMEVLDRLFEEAANVCFVSDGLVTAGAIERRLGLPADFHRVLSPESVRAAVEEMEKGQQFYIVRTDINSDDRTAEAFLDWLSGDQARSITNVTVFRGTETLFDFLISSRLGEADLIEALVRMDPSGRRLSLTQALRPRQDEPAPVEAPGEAPLAQGAAITPEMLETIGEISANQAMVQHLLTELAEADLAEATEALVRQAAGDWAAARGPVRALLEAHGARLQEIVQAGTQLTAQLAALQEETVTQRARPASTVLRPLRTFAETLARRRRREVCLTTSGDELALDLALLERLRGFLRGLVALRLDQDRGAPGTLHVSLWRDEERVTVLVQDDGAPEPDSPALADLAAEVGQAGGALRSVPLPGGGMRFHLGLPLSMVVLEGMVVGVDGMRYVLPVESIRTILQADAAAAMTISAAGGQRVLRLSETEIVAIHSLRGHPQEGHRERPWPASRRVYVVLGTGPRSVAIPVDELVGQQLVLLRPLRGVLARLTHLTGLALLAGGDVGMVLSANRICPPLPAEAG DIP protein Q8KLS0 original sequence version: 28 DIP protein Q8KLS0 original sequence version: 27 cheb2_cersp Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon cheB2 protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MKAAADRLMAARAREGRTRVLIVDDSAMVRQALALGLSTDPRLEVVGTASGAEAARAQMAALKPDVVTLDLEMPQMDGLTFLRSYMESAPVPTVVISSLTRTSGETAMRAMEAGAVDIISKPSLGAGQGLPAIMRDVCARVWAAARARLALPDGAAPAPVAPGASEDWIHALGASTGGVQALSRILPFFPAQSPGLLVVQHMPEGFTAAFARRLDALCRMRVREAADGDLVLPGLVLIAPGGLRHMEIERAGGVCRVRLVAGAPVSYSRPSVDRMFLSLAAAAGPRVSAALLTGMGRDGAAGLLAIRRAGGRTFAQDEGSSAVFGMPLAARDLRAAEEILTLDDIPARMMLAAAADTRAPSLASND DIP protein Q8KLS5 original sequence version: 40 q8kls1_cersp cheY6 EBL86_09020 protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MPYNVMIVDDAAMMRLYIASFIKTLPDFKVVAQAANGQEALDKLAAQPNVDLILLDIEMPVMDGMEFLRHAKLKTRAKICMLSSVAVSGSPHAARARELGADGVVAKPSGTVSHDLEEKTGGELARTMRTLMAA DIP protein Q8KLS1 original sequence version: 38 DIP protein Q8KLS1 original sequence version: 36 chea3-cheb2-1 3 9 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli 8 phosphate donor phosphate donor unspecified role unspecified role Region 1-154 Region 1-154 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer chea3-chey6-1 2 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 8 enzyme enzyme unspecified role unspecified role Region 549-749 Region 549-749 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation chea3-chey6-2 4 10 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli 8 phosphate donor phosphate donor unspecified role unspecified role Region 1-154 Region 1-154 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer chea3-chea4-1 1 6 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 8 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-154 Region 1-154 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation chea3-chey-1 5 7 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli 8 phosphate donor phosphate donor unspecified role unspecified role Region 1-154 Region 1-154 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer