DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel anti tag western anti tag western blot anti tag western Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133466X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133462X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions mouse Mus musculus Mouse comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133464X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133460X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133458X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133461X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133459X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133457X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133463X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel anti tag western anti tag western blot anti tag western Liu M., Zhou L., Xu A., Lam KS., Wetzel MD., Xiang R., Zhang J., Xin X., Dong LQ., Liu F. DIP original experiment: DIP-133465X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A disulfide-bond A oxidoreductase-like protein (DsbA-L) regulates adiponectin multimerization. paqr1_human Adiponectin receptor protein 1 ADIPOR1 PAQR1 CGI-45 Progestin and adipoQ receptor family member I TESBP1A Progestin and adipoQ receptor family member 1 protein protein human Homo sapiens Human MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL DIP protein Q96A54 original sequence version: 66 1CC0300A7D178EB0 gstk1_mouse Glutathione S-transferase kappa 1 Gstk1 Glutathione S-transferase subunit 13 GST 13-13 GST class-kappa GSTK1-1 protein protein mouse Mus musculus Mouse MGPAPRILELFYDVLSPYSWLGFEVLCRYQHLWNIKLQLRPTLIAGIMKDSGNQPPAMVPRKGQYIFKEIPLLKQFFQVPLNIPKDFFGETVKKGSINAMRFLTTVSMEQPEMLEKVSREIWMRVWSRDEDITEYQSILAAAVKAGMSTAQAQHFLEKISTQQVKNKLIENTDAACKYGAFGLPTTVAHVDGKTYMLFGSDRLELLAYLLGEKWMGPVPPTANARL DIP protein Q9DCM2 original sequence version: 66 mint 480332FD618ABCDD adipo_mouse Adiponectin Apm1 Adipocyte, C1q and collagen domain-containing protein 30 kDa adipocyte complement-related protein Adipocyte complement-related 30 kDa protein Adipocyte-specific protein AdipoQ Adipoq Acdc Acrp30 protein protein mouse Mus musculus Mouse MLLLQALLFLLILPSHAEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN DIP protein Q60994 original sequence version: 102 mint Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW 0ECC687D9A8E8123 gstk1_human Glutathione S-transferase kappa 1 Glutathione S-transferase subunit 13 GST 13-13 GST class-kappa GSTK1-1 GSTK1 HDCMD47P protein protein human Homo sapiens Human MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL DIP protein Q9Y2Q3 original sequence version: 88 D3FDAFD1533B58A4 adipoq-adipor1-1 8 13 unspecified role unspecified role bait bait Region 17-247 Region 17-247 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction adipoq-8 10 13 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association gstk1-adipoq-1 4 12 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association adipoq-2 1 13 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association adipoq-3 2 13 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association gstk1-adipoq-2 5 12 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association adipoq-4 9 13 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association adipoq-gstk1-1 6 13 unspecified role unspecified role bait bait Region 17-247 Region 17-247 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction gstk1-adipoq-3 7 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association adipoq-5 3 13 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association