DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lai KO., Zhao Y., Ch'ng TH., Martin KC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lai KO., Zhao Y., Ch'ng TH., Martin KC. DIP original experiment: DIP-133439X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lai KO., Zhao Y., Ch'ng TH., Martin KC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lai KO., Zhao Y., Ch'ng TH., Martin KC. DIP original experiment: DIP-133438X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lai KO., Zhao Y., Ch'ng TH., Martin KC. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lai KO., Zhao Y., Ch'ng TH., Martin KC. DIP original experiment: DIP-133440X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Importin-mediated retrograde transport of CREB2 from distal processes to the nucleus in neurons. ima5_mouse Importin subunit alpha-5 Kpna1 Rch2 Importin alpha-S1 Karyopherin subunit alpha-1 SRP1-beta RAG cohort protein 2 Nucleoprotein interactor 1 protein protein mouse Mus musculus Mouse MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMTDMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRNVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLNCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL DIP protein Q60960 original sequence version: 94 mint Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus 8FE16ACA99F2BA4F q6qjf2_aplca Importin subunit alpha protein protein aplca Aplysia californica (California sea hare) California sea hare MATDPAGKGTRGLMFKNKGKDADEMRRRRTEVTVELRKNKKEEHMLKRRNVPTQDSTDSEDNEKPTTQSLETIVANASSPEPEVQLGAVQAARKLLSSDRNPPIDDLITSGILPILVNCLSRDDNPSLQFEAAWAITNIASGTSAQTQAVVNAGAVPFFLQLLRSPHQNVCEQAVWALGNIIGDGPECRNYVISLGAVQHLLTFINPNIPLPFLRNVAWVIVNLCRNKDPPPPAETIEEILPALCTLIHHSDVNILVDTVWALSYLTDGGNDQIQMVIDSGVVPFLVPLLCHQDVKLQTAALRAVGNIVTGTDEQTQAVLNCNALQHFSSLLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDASLIPLIIHHLNRGDFQTQKEAAWAISNLTISGKKEQVAYVVEMGVLPPFCNLLSVKDAQVVNVVLDGINNILKMAGEDVDQICQIIEECGGLDKIENLQNHENEEIYKLSYEIIDSFFQDEDQEESLLPQASQEGYQFDPNAQIPQEGFKF DIP protein Q6QJF2 original sequence version: 26 atf4_mouse Cyclic AMP-dependent transcription factor ATF-4 Atf4 C/EBP-related ATF Activating transcription factor 4 Creb2 Cyclic AMP-responsive element-binding protein 2 protein protein mouse Mus musculus Mouse MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP DIP protein Q06507 original sequence version: 77 DIP protein Q06507 original sequence version: 105 0C3F895755B1C7B9 ima7_mouse Importin subunit alpha-7 Kpna6 Importin alpha-S2 Karyopherin subunit alpha-6 Kpna5 protein protein mouse Mus musculus Mouse METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPGVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSLCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL DIP protein O35345 original sequence version: 85 553A6265023052AC q16946_aplca ApCREB2 protein protein aplca Aplysia californica (California sea hare) California sea hare MELDLWSEDFQLAREWGLEMPVVQTDGQFGDLKSTSRHGGDESLSLQPQGATLKLEPFEEDVLGAEWMESSDLGSFLDALGDNHERLHPFESNLLEFTSLITPDDSTVSKDILSSTLQFPTQPVNIPLYASHGAEDFSAETEFENHLSPPDSPEQVAPVINLEPVELTASHMTVISPDGLLGGMELASESLTFTELDFVNFNDSAVGSIGGAEELLGSPLSVDDVESTISFSGPSSPETSQSSIIESSPELYKVISTSSIDASKRFSPYSRSSKSKQSVKTSDAKAPRKTRTPAQPVPEHVIMEHLDKKDRKKLQNKNAAIRYRMKKKGEAQGIKGEEQELEELNTKLKTKVDDLQREIKYMKNLMEDVCKAKGIQLK DIP protein Q16946 original sequence version: 48 atf4-kpna6-1 3 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association atf4-kpna1-1 2 4 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association apcreb2-q6qjf2_aplca-1 1 5 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association