DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Architecture of the pontin/reptin complex, essential in the assembly of several macromolecular complexes. Architecture of the pontin/reptin complex, essential in the assembly of several macromolecular complexes. Structure (London, England : 1993) 2008 imex curation Torreira E., Jha S., López-Blanco JR., Arias-Palomo E., Chacón P., Cañas C., Ayora S., Dutta A., Llorca O. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Torreira E., Jha S., López-Blanco JR., Arias-Palomo E., Chacón P., Cañas C., Ayora S., Dutta A., Llorca O. DIP original experiment: DIP-113226X Structure (London, England : 1993) 2008 IMEx Architecture of the pontin/reptin complex, essential in the assembly of several macromolecular complexes. Architecture of the pontin/reptin complex, essential in the assembly of several macromolecular complexes. Architecture of the pontin/reptin complex, essential in the assembly of several macromolecular complexes. Structure (London, England : 1993) 2008 imex curation Torreira E., Jha S., López-Blanco JR., Arias-Palomo E., Chacón P., Cañas C., Ayora S., Dutta A., Llorca O. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Torreira E., Jha S., López-Blanco JR., Arias-Palomo E., Chacón P., Cañas C., Ayora S., Dutta A., Llorca O. DIP original experiment: DIP-113227X Structure (London, England : 1993) 2008 IMEx Architecture of the pontin/reptin complex, essential in the assembly of several macromolecular complexes. ruvb2_yeast RuvB-like protein 2 TIP49-homology protein 2 TIP49b homolog RVB2 TIH2 TIP49B YPL235W P1060 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE 0D8EFBA7EC711AB8 0D8EFBA7EC711AB8 ruvb1_yeast RuvB-like protein 1 RVB1 TIP49-homology protein 1 TIP49a homolog TIH1 TIP49A YDR190C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYL 93D6ECB7006AF0F2 93D6ECB7006AF0F2 pontin-reptin-1 1 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction pontin-reptin-2 2 3 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction