DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structure (London, England : 1993) 2008 imex curation Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113220X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structure (London, England : 1993) 2008 imex curation Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113221X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structure (London, England : 1993) 2008 imex curation Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113223X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structure (London, England : 1993) 2008 imex curation Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kukimoto-Niino M., Sakamoto A., Kanno E., Hanawa-Suetsugu K., Terada T., Shirouzu M., Fukuda M., Yokoyama S. DIP original experiment: DIP-113222X Structure (London, England : 1993) 2008 IMEx Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. rb27b_mouse Ras-related protein Rab-27B Rab27b protein protein mouse Mus musculus Mouse MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC DIP protein Q99P58 original sequence version: 72 01DBC47275B4B955 melph_mouse Melanophilin Mlph Ln Slac2a Exophilin-3 Leaden protein Synaptotagmin-like protein 2a Slp homolog lacking C2 domains a protein protein mouse Mus musculus Mouse MGKRLDLSTLTDEEAEHVWAVVQRDFDLRRREEERLQGLKGKIQKESSKRELLSDTAHLNETHCARCLQPYRLLLNSRRQCLECSLFVCKSCSHAHPEEQGWLCDPCHLARVVKIGSLEWYYQHVRARFKRFGSAKVIRSLCGRLQGGGGSEPSLEEGNGDSEQTDEDGDLDTEARDQPLNSKKKKRLLSFRDVDFEEDSDHLVQPCSQTLGLSSVPESAHSLQSLSGEPYSEDTTSLEPEGLEETGARALGCRPSPEVQPCSPLPSGEDAHAELDSPAASCKSAFGTTAMPGTDDVRGKHLPSQYLADVDTSDEDSIQGPRAASQHSKRRARTVPETQILELNKRMSAVEHLLVHLENTVLPPSAQEPTVETHPSADTEEETLRRRLEELTSNISGSSTSSEDETKPDGTFLGGSPKVCTDTGHMETQERNPRSPGNPARPTKSTDEELSEMEDRVAMTASEVQQAESEISDIESRIAALRAAGLTVKPSGKPRRKSGIPIFLPRVTEKLDRIPKTPPADPDDQAKMPKATTAVPSLLRRKYSPSSQGVDSGSFDRKSVYRGSLTQRNPNGRRGTARHIFAKPVMAQQP DIP protein Q91V27 original sequence version: 54 C91444B16B8EFA1D rab3a_mouse Ras-related protein Rab-3A Rab3a protein protein mouse Mus musculus Mouse MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC DIP protein P63011 original sequence version: 100 DIP protein P63011 original sequence version: 53 1A3E9F8C9D09EB40 rb27a_mouse Ras-related protein Rab-27A Rab27a protein protein mouse Mus musculus Mouse MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC DIP protein Q9ERI2 original sequence version: 64 C6857EBDD7F38137 mlph-rab27a-6 4 8 unspecified role unspecified role prey prey Q9ERI2:p.Tyr6Phe Y6F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y6F'. Wed May 02 19:46:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr6phe' Tue Jun 30 17:45:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr6Phe' Q9ERI2:p.[Tyr6Phe;Leu84Ile;Phe88Tyr;Asp91Gly] Y6F/L84I/F88Y/D91G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D G certain certain sequence position certain certain certain sequence position certain F Y certain certain sequence position certain certain certain sequence position certain L I certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y6F/L84I/F88Y/D91G'. Wed May 02 16:47:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr6phe,leu84ile,phe88tyr,asp91gly' Tue Jun 30 20:14:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr6Phe;Leu84Ile;Phe88Tyr;Asp91Gly]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role bait bait Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association mlph-rab27b-1 1 6 unspecified role unspecified role unspecified role unspecified role Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 1-201 Region 1-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mlph-rab27b-2 2 6 unspecified role unspecified role unspecified role unspecified role Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 1-201 Region 1-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mlph-rab3a-1 3 7 unspecified role unspecified role prey prey P63011:p.Phe19Tyr F19Y mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F Y This feature has been corrected as a result of our quality control procedures. The original label was 'F19Y'. Wed May 02 17:56:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe19tyr' Tue Jun 30 19:51:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe19Tyr' P63011:p.Gly94Asp G94D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G D This feature has been corrected as a result of our quality control procedures. The original label was 'G94D'. Wed May 02 16:29:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94asp' Tue Jun 30 16:36:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Asp' P63011:p.[Phe19Tyr;Gly94Asp] F19Y/G94D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G D certain certain sequence position certain certain certain sequence position certain F Y This feature has been corrected as a result of our quality control procedures. The original label was 'F19Y/G94D'. Wed May 02 17:31:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe19tyr,gly94asp' Tue Jun 30 18:52:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe19Tyr;Gly94Asp]' P63011:p.[Ile87Leu;Tyr91Phe;Gly94Asp] I87L/Y91F/G94D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G D certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain I L This feature has been corrected as a result of our quality control procedures. The original label was 'I87L/Y91F/G94D'. Wed May 02 16:57:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile87leu,tyr91phe,gly94asp' Tue Jun 30 18:01:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile87Leu;Tyr91Phe;Gly94Asp]' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role bait bait Region 1-146 Region 1-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association