DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113219X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113213X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113218X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113212X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113216X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113215X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113214X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113211X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113217X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. Structure (London, England : 1993) 2008 imex curation Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chavas LM., Ihara K., Kawasaki M., Torii S., Uejima T., Kato R., Izumi T., Wakatsuki S. DIP original experiment: DIP-113210X Structure (London, England : 1993) 2008 IMEx Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a. rb27a_mouse Ras-related protein Rab-27A Rab27a protein protein mouse Mus musculus Mouse MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC DIP protein Q9ERI2 original sequence version: 64 C6857EBDD7F38137 rb27b_mouse Ras-related protein Rab-27B Rab27b protein protein mouse Mus musculus Mouse MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC DIP protein Q99P58 original sequence version: 72 01DBC47275B4B955 melph_human Melanophilin MLPH SLAC2A Exophilin-3 Synaptotagmin-like protein 2a Slp homolog lacking C2 domains a protein protein human Homo sapiens Human MGKKLDLSKLTDEEAQHVLEVVQRDFDLRRKEEERLEALKGKIKKESSKRELLSDTAHLNETHCARCLQPYQLLVNSKRQCLECGLFTCKSCGRVHPEEQGWICDPCHLARVVKIGSLEWYYEHVKARFKRFGSAKVIRSLHGRLQGGAGPELISEERSGDSDQTDEDGEPGSEAQAQAQPFGSKKKRLLSVHDFDFEGDSDDSTQPQGHSLHLSSVPEARDSPQSLTDESCSEKAAPHKAEGLEEADTGASGCHSHPEEQPTSISPSRHGALAELCPPGGSHRMALGTAAALGSNVIRNEQLPLQYLADVDTSDEESIRAHVMASHHSKRRGRASSESQIFELNKHISAVECLLTYLENTVVPPLAKGLGAGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS DIP protein Q9BV36 original sequence version: 130 DIP protein Q9BV36 original sequence version: 65 mint Rab effector protein involved in melanosome transport. Serves as link between melanosome-bound RAB27A and the motor protein MYO5A Defects in MLPH are a cause of Griscelli syndrome type-3 (GS3) [MIM:609227]. GS3 is a rare autosomal recessive disorder characterized by pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, and an accumulation of melanosomes in melanocytes, without other clinical manifestations 90F48D0B3250AD98 q9r0q1-1 Synaptotagmin-like protein 4 Sytl4 Slp4 Granuphilin-a Exophilin-2 Granuphilin protein protein mouse Mus musculus Mouse MSEILDLSFLSEMERDLILGVLQRDEELRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRTCARCQEGLGRLIPKSSTCVGCNHLVCRECRVLESNGSWRCKVCSKEIELKKATGDWFYDQKVNRFDYRTGSEIIRMSLRQKPAVNKRETAGQSLLQQTQMGDIWPGRRIIQEQQQREQSVLFEVPKTRSGKSALEAESESLDSYTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKEIPPGNQNAVCGDEGDMVFKKNTKKVLRPSEYTKSVIDLRPEDVAQESGILGDRSKSVPGLSVDMEEEEEEEEDIDHLVKLHRQKLARGSMQSGSSMSTLGSIMSIYSEAGDFGNISVTGKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYEISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMVKQKLGV DIP protein Q9R0Q1-1 original sequence version: 63 sytl2_human Synaptotagmin-like protein 2 KIAA1597 SGA72M SLP2 SLP2A Breast cancer-associated antigen SGA-72M Exophilin-4 SYTL2 protein protein human Homo sapiens Human MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGADIIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSVIDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTSIQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSSTDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHGREVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGLHSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEEEPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK DIP protein Q9HCH5 original sequence version: 61 4531F9CDD02F25DE sytl2-rab27a-2 4 15 unspecified role unspecified role bait bait Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9ERI2:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S/C188S'. Wed May 02 19:07:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser,cys188ser' Tue Jun 30 19:01:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys123Ser;Cys188Ser]' ecolx Escherichia coli direct interaction direct interaction rab27a-sytl2-1 10 15 unspecified role unspecified role unspecified role unspecified role Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mlph-rab27b-3 9 13 unspecified role unspecified role bait bait Region 13-129 Region 13-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Q99P58:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C188S'. Wed May 02 15:29:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 17:12:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' Q99P58:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S/C188S'. Wed May 02 15:27:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser,cys188ser' Tue Jun 30 18:08:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys123Ser;Cys188Ser]' ecolx Escherichia coli direct interaction direct interaction sytl4-rab27b-1 6 12 unspecified role unspecified role prey prey Q99P58:p.Cys123Ser C123S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S'. Wed May 02 16:58:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser' Tue Jun 30 17:52:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys123Ser' Q99P58:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C188S'. Wed May 02 18:30:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 19:54:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' Q99P58:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S/C188S'. Wed May 02 17:19:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser,cys188ser' Tue Jun 30 16:05:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys123Ser;Cys188Ser]' ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 12-128 Region 12-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction rab27a-sytl4-3 3 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait Region 57-66 Region 57-66 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sytl4-rab27a-2 7 14 unspecified role unspecified role bait bait Region 12-128 Region 12-128 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9ERI2:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S/C188S'. Wed May 02 15:13:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser,cys188ser' Tue Jun 30 19:26:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys123Ser;Cys188Ser]' Q9ERI2:p.Cys123Ser C123S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S'. Wed May 02 15:48:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser' Tue Jun 30 19:05:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys123Ser' Q9ERI2:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C188S'. Wed May 02 16:58:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 17:15:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' ecolx Escherichia coli direct interaction direct interaction mlph-rab27a-5 5 13 unspecified role unspecified role bait bait Region 13-129 Region 13-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Q9ERI2:p.Cys188Ser C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C188S'. Wed May 02 15:11:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 17:09:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' Q9ERI2:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S/C188S'. Wed May 02 17:31:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser,cys188ser' Tue Jun 30 17:14:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys123Ser;Cys188Ser]' Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rab27a-sytl2-2 8 15 unspecified role unspecified role unspecified role unspecified role Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-193 Region 1-193 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sytl2-rab27b-1 2 12 unspecified role unspecified role prey prey Q99P58:p.[Cys123Ser;Cys188Ser] C123S/C188S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C123S/C188S'. Wed May 02 19:59:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ser,cys188ser' Tue Jun 30 20:01:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys123Ser;Cys188Ser]' ecolx Escherichia coli 15 unspecified role unspecified role bait bait Region 10-62 Region 10-62 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rab27a-sytl2-3 1 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 11 unspecified role unspecified role bait bait Region 57-66 Region 57-66 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction