DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions mouse Mus musculus Mouse bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133410X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions mouse Mus musculus Mouse bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133415X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133423X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133422X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133418X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133429X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133428X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133419X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133412X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133424X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133427X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133420X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133426X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions mouse Mus musculus Mouse bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133416X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions mouse Mus musculus Mouse bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133417X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions mouse Mus musculus Mouse bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133414X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133421X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133413X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133425X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Vincenz C., Kerppola TK. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vincenz C., Kerppola TK. DIP original experiment: DIP-133411X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Different polycomb group CBX family proteins associate with distinct regions of chromatin using nonhomologous protein sequences. cbx8_human Chromobox protein homolog 8 Polycomb 3 homolog Rectachrome 1 CBX8 PC3 RC1 protein protein human Homo sapiens Human MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR DIP protein Q9HC52 original sequence version: 81 DIP protein Q9HC52 original sequence version: 80 DIP protein Q9HC52 original sequence version: 102 DIP protein Q9HC52 original sequence version: 107 651263C85B0ECD93 cbx7_human Chromobox protein homolog 7 CBX7 protein protein human Homo sapiens Human MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF DIP protein O95931 original sequence version: 81 DIP protein O95931 original sequence version: 82 DIP protein O95931 original sequence version: 108 A90019C1D08812B8 h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 o00257-1 E3 SUMO-protein ligase CBX4 CBX4 Chromobox protein homolog 4 Polycomb 2 homolog protein protein human Homo sapiens Human MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGAKSHPPDKWAQGAGAKGYLGAVKPLAGAAGAPGKGSEKGPPNGMMPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEVAEGEARSPSHKKRAADERHPPADRTFKKAAGAEEKKVEAPPKRREEEVSGVSDPQPQDAGSRKLSPTKEAFGEQPLQLTTKPDLLAWDPARNTHPPSHHPHPHPHHHHHHHHHHHHAVGLNLSHVRKRCLSETHGEREPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV DIP protein O00257-1 original sequence version: 86 DF5C8C4C0CCB1F31 h33_human Histone H3.3 H3-3A H3-3B H3.3A H3.3B H3F3 H3F3A H3F3B PP781 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P84243 original sequence version: 72 DIP protein P84243 original sequence version: 73 DIP protein P84243 original sequence version: 97 DIP protein P84243 original sequence version: 125 DIP protein P84243 original sequence version: 110 DIP protein P84243 original sequence version: 96 5158ED279E6F9E1C ring2_human E3 ubiquitin-protein ligase RING2 RING finger protein 2 RING finger protein 1B RING finger protein BAP-1 Protein DinG Huntingtin-interacting protein 2-interacting protein 3 RNF2 BAP1 DING HIPI3 RING1B RING-type E3 ubiquitin transferase RING2 protein protein human Homo sapiens Human MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q99496 original sequence version: 95 DIP protein Q99496 original sequence version: 94 DIP protein Q99496 original sequence version: 96 DIP protein Q99496 original sequence version: 125 DIP protein Q99496 original sequence version: 142 DIP protein Q99496 original sequence version: 159 DIP protein Q99496 original sequence version: 129 DIP protein Q99496 original sequence version: 99 DIP protein Q99496 original sequence version: 118 90EA546E1F4DB7EC cbx6_human Chromobox protein homolog 6 CBX6 protein protein human Homo sapiens Human MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK DIP protein O95503 original sequence version: 80 q14781-1 Chromobox protein homolog 2 CBX2 protein protein human Homo sapiens Human MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEDDSDLDAKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKATRRPVSLAKVLKTARKDLGAPASKLPPPLSAPVAGLAALKAHAKEACGGPSAMATPENLASLMKGMASSPGRGGISWQSSIVHYMNRMTQSQAQAASRLALKAQATNKCGLGLDLKVRTQKGELGMSPPGSKIPKAPSGGAVEQKVGNTGGPPHTHGASRVPAGCPGPQPAPTQELSLQVLDLQSVKNGMPGVGLLARHATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVAPPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY DIP protein Q14781-1 original sequence version: 85 h32_human Histone H3.2 H3C13 H3C14 H3C15 H3-clustered histone 13 H3-clustered histone 14 H3-clustered histone 15 H3F2 H3FM HIST2H3A HIST2H3C HIST2H3D Histone H3/m Histone H3/o protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein Q71DI3 original sequence version: 82 DIP protein Q71DI3 original sequence version: 133 DIP protein Q71DI3 original sequence version: 140 DIP protein Q71DI3 original sequence version: 107 6FD8508EA50A0EEC cbx6-rnf2-2 11 27 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 26 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx2-hist2h3a-1 1 28 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 29 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse direct interaction direct interaction cbx4-rnf2-1 13 24 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 26 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx8-hist1h3a-1 17 21 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx7-hist2h3a-1 14 22 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 29 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse direct interaction direct interaction cbx2-hist1h3a-1 20 28 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx8-hist2h3a-1 15 21 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 29 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse direct interaction direct interaction cbx7-rnf2-3 7 22 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 26 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx6-h3f3a-1 3 27 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 25 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx4-h3f3a-1 4 24 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 25 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx2-h3f3a-1 9 28 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 25 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx7-h3f3a-1 10 22 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 25 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx2-rnf2-1 18 28 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 26 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx4-hist1h3a-1 5 24 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx6-hist1h3a-1 8 27 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx8-rnf2-4 6 21 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 26 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx4-hist2h3a-1 16 24 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 29 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse direct interaction direct interaction cbx6-hist2h3a-1 2 27 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 29 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse direct interaction direct interaction cbx7-hist1h3a-1 12 22 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 23 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cbx8-h3f3a-1 19 21 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 25 unspecified role unspecified role unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction