DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Regulation of cytotoxic T lymphocyte triggering by PIR-B on dendritic cells. Regulation of cytotoxic T lymphocyte triggering by PIR-B on dendritic cells. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Endo S., Sakamoto Y., Kobayashi E., Nakamura A., Takai T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Endo S., Sakamoto Y., Kobayashi E., Nakamura A., Takai T. DIP original experiment: DIP-260452X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of cytotoxic T lymphocyte triggering by PIR-B on dendritic cells. Regulation of cytotoxic T lymphocyte triggering by PIR-B on dendritic cells. Regulation of cytotoxic T lymphocyte triggering by PIR-B on dendritic cells. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Endo S., Sakamoto Y., Kobayashi E., Nakamura A., Takai T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Endo S., Sakamoto Y., Kobayashi E., Nakamura A., Takai T. DIP original experiment: DIP-260451X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of cytotoxic T lymphocyte triggering by PIR-B on dendritic cells. ha1b_mouse H-2 class I histocompatibility antigen, K-B alpha chain H2-K1 H2-K protein protein mouse Mus musculus Mouse MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA DIP protein P01901 original sequence version: 139 3D2F125318193443 cd8a_rat T-cell surface glycoprotein CD8 alpha chain Cd8a CD8 antigen 32 kDa chain OX-8 membrane antigen protein protein rat Rattus norvegicus (Rat) Rat MASRVICFLSLNLLLLDVITRLQVSGQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWAPLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV ADFAC54E4C99C1BE lirb3_mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 Lilrb3 Pirb Cell-surface glycoprotein p91 Paired immunoglobulin-like receptor B protein protein mouse Mus musculus Mouse MSCTFTALLRLGLTLSLWIPVLTGSLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLKALIGVSVAFILFLFIFIFILLRRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ DIP protein P97484 original sequence version: 91 DIP protein P97484 original sequence version: 77 h2_k1-cd8_alpha-1 2 3 unspecified role unspecified role bait bait mouse Mus musculus Mouse 4 unspecified role unspecified role prey prey Region 1-151 Region 1-151 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction h2_k1-lilrb3-1 1 5 unspecified role unspecified role prey prey Region 1-618 Region 1-618 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 3 unspecified role unspecified role bait bait mouse Mus musculus Mouse direct interaction direct interaction