DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure (London, England : 1993) 2008 imex curation Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. DIP original experiment: DIP-110830X Structure (London, England : 1993) 2008 IMEx Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure (London, England : 1993) 2008 imex curation Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. DIP original experiment: DIP-110829X Structure (London, England : 1993) 2008 IMEx Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure (London, England : 1993) 2008 imex curation Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. DIP original experiment: DIP-110827X Structure (London, England : 1993) 2008 IMEx Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure (London, England : 1993) 2008 imex curation Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. DIP original experiment: DIP-110831X Structure (London, England : 1993) 2008 IMEx Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. Structure (London, England : 1993) 2008 imex curation Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ghazi-Tabatabai S., Saksena S., Short JM., Pobbati AV., Veprintsev DB., Crowther RA., Emr SD., Egelman EH., Williams RL. DIP original experiment: DIP-110828X Structure (London, England : 1993) 2008 IMEx Structure and disassembly of filaments formed by the ESCRT-III subunit Vps24. vps24_yeast Vacuolar protein-sorting-associated protein 24 YKL041W YKL254 VPS24 DID3 DOA4-independent degradation protein 3 ESCRT-III complex subunit VPS24 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKNVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRALQN 6073C1B680D58E98 6073C1B680D58E98 vps24/vps2 VPS24-VPS2 Chimera protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast SQLQSTPQNLVSNAPIAETAMGIPEPIGAGSEFHGNPDDDLQARLNTLKKQTMDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKF snf7_yeast Vacuolar-sorting protein SNF7 SNF7 VPS32 YLR025W DID1 Vacuolar protein-sorting-associated protein 32 DOA4-independent degradation protein 1 Sucrose nonfermenting protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MWSSLFGWTSSNAKNKESPTKAIVRLREHINLLSKKQSHLRTQITNQENEARIFLTKGNKVMAKNALKKKKTIEQLLSKVEGTMESMEQQLFSIESANLNLETMRAMQEGAKAMKTIHSGLDIDKVDETMDEIREQVELGDEISDAISRPLITGANEVDEDELDEELDMLAQENANQETSKIVNNNVNAAPISENKVSLPSVPSNKIKQSENSVKDGEEEEDEEDEDEKALRELQAEMGL 5241A18BB181F0C1 5241A18BB181F0C1 scvps24-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction scsnf7-1 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction scvps24-2 5 6 unspecified role unspecified role unspecified role unspecified role Region 1-9 Region 1-9 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P36095:p.[Lys5Asp;Lys6Asp] K5D/K6D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain K D This feature has been corrected as a result of our quality control procedures. The original label was 'K5D/K6D'. Wed May 02 19:54:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys5asp,lys6asp' Tue Jun 30 18:37:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys5Asp;Lys6Asp]' P36095:p.Lys55Ala K55A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K55A'. Wed May 02 14:46:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys55ala' Tue Jun 30 17:31:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys55Ala' P36095:p.[Lys133Asp;Glu134Ala;Lys137Asp] K133D/E134A/K137D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain K D This feature has been corrected as a result of our quality control procedures. The original label was 'K133D/E134A/K137D'. Wed May 02 19:43:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys133asp,glu134ala,lys137asp' Tue Jun 30 20:10:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys133Asp;Glu134Ala;Lys137Asp]' P36095:p.[Arg120Glu;Leu124Asp;Lys133Asp] R120E/L124D/K133D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R120E/L124D/K133D'. Wed May 02 20:22:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg120glu,leu124asp,lys133asp' Tue Jun 30 19:07:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg120Glu;Leu124Asp;Lys133Asp]' P36095:p.[Leu124Asp;Arg125Glu] L124D/R125E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L124D/R125E'. Wed May 02 18:34:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu124asp,arg125glu' Tue Jun 30 19:28:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu124Asp;Arg125Glu]' P36095:p.[Arg120Glu;Leu121Asp] R120E/L121D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R120E/L121D'. Wed May 02 15:01:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg120glu,leu121asp' Tue Jun 30 17:50:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg120Glu;Leu121Asp]' ecolx Escherichia coli direct interaction direct interaction scsnf7-2 1 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction vps24/vps2-1 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction