DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Park ST., Kang CM., Husson RN. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Park ST., Kang CM., Husson RN. DIP original experiment: DIP-113366X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Park ST., Kang CM., Husson RN. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park ST., Kang CM., Husson RN. DIP original experiment: DIP-113364X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Park ST., Kang CM., Husson RN. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park ST., Kang CM., Husson RN. DIP original experiment: DIP-113365X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. pstp_myctu Serine/threonine protein phosphatase PstP pstP Mycobacterial Ser/Thr phosphatase mstp ppp Rv0018c PP2C-family Ser/Thr phosphatase protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MARVTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEVASQLVIAALAHLDDDEPGGDLLAKLDAAVRAGNSAIAAQVEMEPDLEGMGTTLTAILFAGNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITPEEAHSHPQRSLIMRALTGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETILEALQIPEVAESAHRLIELALRGGGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQLTLPNTAAGRASAISQRKEIVKRVPPQADTFSRPRWSGRRLAFVVALVTVLMTAGLLIGRAIIRSNYYVADYAGSVSIMRGIQGSLLGMSLHQPYLMGCLSPRNELSQISYGQSGGPLDCHLMKLEDLRPPERAQVRAGLPAGTLDDAIGQLRELAANSLLPPCPAPRATSPPGRPAPPTTSETTEPNVTSSPASPSPTTSAPAPTGTTPAIPTSASPAAPASPPTPWPVTSSPTMAALPPPPPQPGIDCRAAA DD78F54D2FC19D95 sigh_myctu ECF RNA polymerase sigma factor SigH sigH Alternative RNA polymerase sigma factor SigH RNA polymerase sigma-H factor rpoE MTCY07D11.03 Rv3223c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS AC0C33B47DB40CFD rsha_myctu Anti-sigma factor RshA rshA Regulator of SigH Sigma-H anti-sigma factor RshA Rv3221A protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHYGLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP 36636191A0D86341 pknb-sigh-1 2 5 enzyme target enzyme target substrate substrate unspecified role unspecified role P9WGH9:p.[Thr26Ala;Thr106Ala] T26A/T106A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T26A/T106A'. Wed May 02 16:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr26ala,thr106ala' Tue Jun 30 17:58:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr26Ala;Thr106Ala]' ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pknb-rsha-1 3 6 enzyme target enzyme target substrate substrate unspecified role unspecified role P9WJ69:p.Thr94Ala T94A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T94A'. Wed May 02 16:24:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr94ala' Tue Jun 30 18:09:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr94Ala' ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rsha-sigh-1 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction