DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ishikawa H., Barber GN. DIP original experiment: DIP-259572X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ishikawa H., Barber GN. DIP original experiment: DIP-259575X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ishikawa H., Barber GN. DIP original experiment: DIP-259579X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ishikawa H., Barber GN. DIP original experiment: DIP-259573X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ishikawa H., Barber GN. DIP original experiment: DIP-259576X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ishikawa H., Barber GN. DIP original experiment: DIP-259577X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ishikawa H., Barber GN. DIP original experiment: DIP-259574X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. Nature 2008 imex curation Ishikawa H., Barber GN. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ishikawa H., Barber GN. DIP original experiment: DIP-259578X Nature 2008 IMEx STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling. o95786-1 Antiviral innate immune response receptor RIG-I Probable ATP-dependent RNA helicase DDX58 DDX58 DEAD box protein 58 RIG-I-like receptor 1 Retinoic acid-inducible gene 1 protein Retinoic acid-inducible gene I protein protein protein human Homo sapiens Human MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK DIP protein O95786-1 original sequence version: 126 DIP protein O95786-1 original sequence version: 118 DIP protein O95786 original sequence version: 63 DIP protein O95786 original sequence version: 116 DIP protein O95786-1 original sequence version: 116 DIP protein O95786 original sequence version: 105 DIP protein O95786 original sequence version: 80 DIP protein O95786-1 original sequence version: 78 DIP protein O95786 original sequence version: 102 DIP protein O95786-1 original sequence version: 131 DIP protein O95786 original sequence version: 134 DIP protein O95786 original sequence version: 135 DIP protein O95786-1 original sequence version: 120 DIP protein O95786 original sequence version: 120 ssrb_human Translocon-associated protein subunit beta SSR2 TRAPB Signal sequence receptor subunit beta HSD25 protein protein human Homo sapiens Human MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN DIP protein P43308 original sequence version: 113 575715449B8586D8 sc61b_human Protein transport protein Sec61 subunit beta SEC61B protein protein human Homo sapiens Human MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS DIP protein P60468 original sequence version: 100 DIP protein P60468 original sequence version: 80 DIP protein P60468 original sequence version: 77 5FAFF4197A62FA49 tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9UHD2 original sequence version: 116 DIP protein Q9UHD2 original sequence version: 120 DIP protein Q9UHD2 original sequence version: 79 DIP protein Q9UHD2 original sequence version: null B58E4FE1B502276D q7z434-1 Mitochondrial antiviral-signaling protein MAVS IPS1 KIAA1271 VISA CARD adapter inducing interferon beta Interferon beta promoter stimulator protein 1 Putative NF-kappa-B-activating protein 031N Virus-induced-signaling adapter protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH DIP protein Q7Z434-1 original sequence version: 117 DIP protein Q7Z434 original sequence version: 109 DIP protein Q7Z434 original sequence version: 112 DIP protein Q7Z434 original sequence version: 52 DIP protein Q7Z434 original sequence version: 107 DIP protein Q7Z434-1 original sequence version: 107 DIP protein Q7Z434 original sequence version: 95 DIP protein Q7Z434 original sequence version: 69 DIP protein Q7Z434 original sequence version: 72 DIP protein Q7Z434-1 original sequence version: 72 DIP protein Q7Z434 original sequence version: 92 DIP protein Q7Z434 original sequence version: 129 DIP protein Q7Z434 original sequence version: 111 sting_human Stimulator of interferon genes protein STING1 ERIS Endoplasmic reticulum interferon stimulator MITA Mediator of IRF3 activation TMEM173 Transmembrane protein 173 protein protein human Homo sapiens Human MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS DIP protein Q86WV6 original sequence version: 83 DIP protein Q86WV6 original sequence version: 47 DIP protein Q86WV6 original sequence version: 50 DIP protein Q86WV6 original sequence version: 100 DIP protein Q86WV6 original sequence version: 68 CB54D6A4D4D8E7C0 tmem173-ssr2-1 1 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait Region 173-379 Region 173-379 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tmem173-tbk1-1 8 12 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ddx58-tmem173-1 2 9 unspecified role unspecified role bait bait Region 1-284 Region 1-284 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tmem173-sec61b-1 6 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association tmem173-ssr2-2 4 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait Region 173-379 Region 173-379 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association tmem173-mavs-1 3 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ssr2-sec61b-1 5 10 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human association association tmem173-ddx58-1 7 14 unspecified role unspecified role bait bait human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association