DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133216X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133217X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133206X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro pla proximity ligation assay pELISA pELISA PLA predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133215X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133221X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133209X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133208X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133218X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133213X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133220X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133211X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133219X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133210X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133212X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133214X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Katz C., Benyamini H., Rotem S., Lebendiker M., Danieli T., Iosub A., Refaely H., Dines M., Bronner V., Bravman T., Shalev DE., Rüdiger S., Friedler A. DIP original experiment: DIP-133207X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB aspp2_human Apoptosis-stimulating of p53 protein 2 TP53BP2 ASPP2 BBP Tumor suppressor p53-binding protein 2 Bcl2-binding protein Renal carcinoma antigen NY-REN-51 protein protein human Homo sapiens Human MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA DIP protein Q13625 original sequence version: 114 DIP protein Q13625 original sequence version: 156 DIP protein Q13625-1 original sequence version: 156 DIP protein Q13625 original sequence version: 160 DIP protein Q13625-1 original sequence version: 86 C75D056FBC1DAD75 bcl2-tp53bp2-1 3 19 unspecified role unspecified role unspecified role unspecified role binding site 7-24 binding site 7-24 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2l2-tp53bp2-1 13 17 unspecified role unspecified role unspecified role unspecified role binding site 6-28 binding site 6-28 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-2 15 19 unspecified role unspecified role unspecified role unspecified role binding site 988-1002 binding site 988-1002 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2l1-tp53bp2-1 8 18 unspecified role unspecified role unspecified role unspecified role binding site 104-123 binding site 104-123 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2l2-tp53bp2-2 16 17 unspecified role unspecified role unspecified role unspecified role binding site 6-28 binding site 6-28 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2l1-tp53bp2-2 11 18 unspecified role unspecified role unspecified role unspecified role binding site 6-26 binding site 6-26 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tp53bp2-bcl2-1 4 19 unspecified role unspecified role prey prey binding site 7-24 binding site 7-24 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role bait bait binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-3 12 19 unspecified role unspecified role unspecified role unspecified role binding site 993-1004 binding site 993-1004 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2l1-tp53bp2-3 7 18 unspecified role unspecified role unspecified role unspecified role binding site 6-26 binding site 6-26 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-4 14 19 unspecified role unspecified role unspecified role unspecified role binding site 931-942 binding site 931-942 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-5 1 19 unspecified role unspecified role unspecified role unspecified role binding site 45-108 binding site 45-108 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-6 10 19 unspecified role unspecified role unspecified role unspecified role binding site 993-1004 binding site 993-1004 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-7 6 19 unspecified role unspecified role unspecified role unspecified role binding site 7-24 binding site 7-24 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-8 9 19 unspecified role unspecified role unspecified role unspecified role binding site 945-961 binding site 945-961 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2l2-tp53bp2-3 2 17 unspecified role unspecified role unspecified role unspecified role binding site 41-67 binding site 41-67 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2-tp53bp2-9 5 19 unspecified role unspecified role unspecified role unspecified role binding site 1039-1053 binding site 1039-1053 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 20 unspecified role unspecified role unspecified role unspecified role binding site 893-1128 binding site 893-1128 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction