DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111278X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.4 Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111275X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111279X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.4 Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111280X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SIF S5 Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111274X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.2 Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111277X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Retinoic acid-stimulated sequential phosphorylation, PML recruitment, and SUMOylation of nuclear receptor TR2 to suppress Oct4 expression. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gupta P., Ho PC., Huq MM., Ha SG., Park SW., Khan AA., Tsai NP., Wei LN. DIP original experiment: DIP-111276X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SIF S5 sumo1_mouse Small ubiquitin-related modifier 1 Sumo1 Smt3c Smt3h3 Ubl1 Ubiquitin-like protein SMT3C SMT3 homolog 3 Ubiquitin-homology domain protein PIC1 protein protein mouse Mus musculus Mouse MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63166 original sequence version: 51 DIP protein P63166 original sequence version: 69 DIP protein P63166 original sequence version: 82 DIP protein P63166 original sequence version: 35 89BE97D2D054FB33 kat2b_mouse Histone acetyltransferase KAT2B Pcaf Lysine acetyltransferase 2B Histone acetyltransferase PCAF Kat2b P300/CBP-associated factor Spermidine acetyltransferase KAT2B protein protein mouse Mus musculus Mouse MAEAGGAGSPALPPAPPHGSPRTLATAAGSSASCGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSPLGIQTVISPPVTGTALFSSNSTSHEQINGGRTSPGCRGSSGLEANPGEKRKMNNSHAPEEAKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPKDPEQLYSTLKNILQQVKNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK DIP protein Q9JHD1 original sequence version: 39 DIP protein Q9JHD1 original sequence version: 76 This sequence has been withdrawn from Uniprot. 38E52F326794F523 nr2c1_mouse Nuclear receptor subfamily 2 group C member 1 Nr2c1 Tr2 Tr2-11 Orphan nuclear receptor TR2 Testicular receptor 2 protein protein mouse Mus musculus Mouse MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSGMFVNIHPSGIKTEPAMLMAPDKAESCQGDLSTLASVVTSLANLGKAKDLSHCGGDMPVVQSLRNGDTSFGAFHHDIQTNGDVSRAFDTLAKALTPGESSACQSPEEGMEGSPHLIAGEPSFVEKEGPLLSESHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSPERRKSLMEHIFKLQEFCNSMVKLCIDGHEYAYLKAIVLFSPDHPGLENMELIERFQEKAYVEFQDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL DIP protein Q505F1 original sequence version: 40 DIP protein Q505F1 original sequence version: 26 nrip1_mouse Nuclear receptor-interacting protein 1 Nrip1 Nuclear factor RIP140 Receptor-interacting protein 140 protein protein mouse Mus musculus Mouse MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAINKKSAGHKEEDQNFNLSGSAFPSCQSNGPTVSTQTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHESLKVEKDLRCYGVASSHLKTLLKKSKTKDQKSGPTLPDVTPNLIRDSFVESSHPAVGQSGTKVMSEPLSCAARLQAVASMVEKRASPAASPKPSVACSQLALLLSSEAHLQQYSREHALKTQNAHQVASERLAAMARLQENGQKDVGSSQLSKGVSGHLNGQARALPASKLVANKNNAATFQSPMGVVPSSPKNTSYKNSLERNNLKQAANNSLLLHLLKSQTIPTPMNGHSQNERASSFESSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPIDLSCKHRIEKPEAERPVSLENLTQSLLNTWDPKIPGVDIKEDQDTSTNSKLNSHQKVTLLQLLLGHKSEETVERNASPQDIHSDGTKFSPQNYTRTSVIESPSTNRTTPVSTPPLYTASQAESPINLSQHSLVIKWNSPPYACSTPASKLTNTAPSHLMDLTKGKESQAEKPAPSEGAQNSATFSASKLLQNLAQCGLQSSGPGEEQRPCKQLLSGNPDKPLGLIDRLNSPLLSNKTNAAEESKAFSSQPAGPEPGLPGCEIENLLERRTVLQLLLGNSSKGKNEKKEKTPARDEAPQEHSERAANEQILMVKIKSEPCDDFQTHNTNLPLNHDAKSAPFLGVTPAIHRSTAALPVSEDFKSEPASPQDFSFSKNGLLSRLLRQNQESYPADEQDKSHRNSELPTLESKNICMVPKKRKLYTEPLENPFKKMKNTAVDTANHHSGPEVLYGSLLHQEELKFSRNELDYKYPAGHSSASDGDHRSWARESKSFNVLKQLLLSENCVRDLSPHRSDSVPDTKKKGHKNNAPGSKPEFGISSLNGLMYSSPQPGSCVTDHRTFSYPGMVKTPLSPPFPEHLGCVGSRPEPGLLNGCSVPGEKGPIKWVIADMDKNEYEKDSPRLTKTNPILYYMLQKGGGNSVTTQETQDKDIWREPASAESLSQVTVKEELLPAAETKASFFNLRSPYNSHMGNNASRPHSTNGEVYGLLGNALTIKKESE DIP protein Q8CBD1 original sequence version: 43 DIP protein Q8CBD1 original sequence version: 32 56ABD0C2A5AAC0A1 q8bsj6_mouse Pml protein protein mouse Mus musculus Mouse YASDQEVLDMHSFLRKALCSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRINAAVASPEAASNQPEAASTHPVTTSTPEDLEQPKEVQSVQAQALELSKTQPVAMVKTVPGAHPVPVYAFSMQGPTYREEASQTVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLPNNNHVTSDTGETEERVVVISSSEDSDTENLSSHELDDSSSESSSLQLEGPNSLKALDESLAEPHLEDRTLVFFDLKIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVLPLIRERIPGASSFKLGNLAKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQTTPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA DIP protein Q8BSJ6 original sequence version: 31 nr2c1-sumo1-1 5 8 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association pml-nr2c1-1 3 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association nr2c1-pml-1 6 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association nr2c1-nrip1-1 4 11 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association sumo1-nr2c1-1 2 10 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 8 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association nr2c1-pml-2 1 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association nr2c1-kat2b-1 7 9 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association