DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133168X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133169X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133170X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133182X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133171X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133185X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133174X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133181X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133184X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133188X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133178X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133173X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133176X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133183X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133177X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133172X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133187X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133180X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133186X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-133179X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sonnberg S., Seet BT., Pawson T., Fleming SB., Mercer AA. DIP original experiment: DIP-254381X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Poxvirus ankyrin repeat proteins are a unique class of F-box proteins that associate with cellular SCF1 ubiquitin ligase complexes. q6tvj2_orfsa protein protein orfsa orfsa OV-SA00 Orf virus-San Angelo 2000 MDFLGAALYDYVADAENVRVDEVRRLLAAGASVEYAGEFGKTALHQYMGRSGTDPAVVRALLDAGARVDLPETCCGCTPVHLCLMSANIDVEVLRMLVHEGRVEDCGRAELASAVLKEFVVNRAFDENVTERVMHVLVSAGADVNAASVVDRTPLHVCLTGMSTHPGTIAALLRFGADVNAVDLCGMSPLAVLVRSRAATAELVRMLLDGGADTHAVDSRLDSLLHQHFQSARPRPEVVHELIRHGCSPRARNRIGNTPLHEAAKHSSCKHSLVGPLLAAGASVDARNNAGRTPLHLAAASNPRACRRLIALGADVVARSYAGVTPLAQLVADNNSALVTAALNTQPEPRAVAESLRATTPVGETACSRLCVAYVVARAPSEVLGEPERALHAAFVAECLAEVAAIHAVRCGTPPVSLLEILVAARPPRSLLSRRARRLAESRTTVYRAPLRARIAAMRHRSRLVERALRALRDCVLPREVLERVLRCLSTQDLRASGLAE 5F8EB10F97243186 rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH DIP protein P62877 original sequence version: 120 DIP protein P62877 original sequence version: 115 DIP protein P62877 original sequence version: 78 DIP protein P62877 original sequence version: 113 DIP protein P62877 original sequence version: 75 DIP protein P62877 original sequence version: 86 DIP protein P62877 original sequence version: 136 DIP protein P62877 original sequence version: 126 DIP protein P62877 original sequence version: 90 DIP protein P62877 original sequence version: 114 30FC5ADF66096C0E p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein P63208-1 original sequence version: 128 DIP protein P63208-1 original sequence version: 116 DIP protein P63208 original sequence version: 76 DIP protein P63208-1 original sequence version: 76 DIP protein P63208 original sequence version: 104 DIP protein P63208 original sequence version: 127 DIP protein P63208 original sequence version: 123 DIP protein P63208 original sequence version: 61 DIP protein P63208 original sequence version: 91 DIP protein P63208 original sequence version: 115 DIP protein P63208 original sequence version: 94 DIP protein P63208 original sequence version: 75 DIP protein P63208 original sequence version: 85 C794D62AFB75528A q6tvj7_orfsa protein protein orfsa orfsa OV-SA00 Orf virus-San Angelo 2000 MENNDGNELNNRHPHVREFKEASLYGFLAAAADVTVEDVRRYIQFGADVNYRGAYLCTPLHVYLRSGCEKRLDVVDALLDAGADINAKEICGLTPVHLYASYAEVDVEFMRGLIERGACVGGENSVTGCLYSYLYTHSVDGGARLDVVELLVQAGADVNVSGEARKTPLHVHCAGFEVDPDIVELLLRAGADPEALDEHGLTPADVLVKSVGANVATLRLFIDAGVSMATSRDARGRTPLHHHADSFRASAGIVRELLAAGCDAAAADDLGNTPLHSLATFCSCRRSVLDQLIAGGADINARNHYGHTCLYYASIYNPSVCSRLIAAGADVTARTPDGRTPLSGMIMRKHTRAVRAALATRPPADAVAASLDVAVQPEPTDATRACVRYVVLCGGTLSARVRSRHADFVRECESEVVVLRTTVVGLPGTSLLDIVRAAQPPPVLLSPRVHHVLQKLRVYTDLVDARLREMRHKTNLVDAVSRLVCPCALPPEVVRGILVHVPTDSLRHTLTLGVAQASRFLPSHK 2F801CCD0AE380E5 cand1_human Cullin-associated NEDD8-dissociated protein 1 KIAA0829 TIP120 TIP120A Cullin-associated and neddylation-dissociated protein 1 p120 CAND1 TBP-interacting protein of 120 kDa A CAND1 protein protein human Homo sapiens Human MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLAKVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLESMDTS DIP protein Q86VP6 original sequence version: 120 DIP protein Q86VP6 original sequence version: 77 DIP protein Q86VP6 original sequence version: 122 FE344558F72D79D8 q6tvw2_orfsa protein protein orfsa orfsa OV-SA00 Orf virus-San Angelo 2000 MSEKGFPTFVNAAAMLSRESVVAPHADLLFRYLESGQVDLATVRALVATDADVNFRGEYGRTPLHLCVHFARHEQCAEIVRVLLEAGADVNAKDTCGFTPLHAYVQHDCVRPEVVALMLEAGADVVCDDSFVFYDSALSSFLSSCGSDGTELEVARLLLDAGARVNEGDTYGMTPLHVYAKNQWIREDVLRLLLERGANPNACDCHGVTPLAALLGSGGVSAALVDVMLRAGADARAVDAYRRTTLHHLARTAKISEGLVRMLTGLGVDPAAVDASGNTMLHYMATYGRCARGVVEFVLERGLDLNLRNNNLQTALHRAAVFSHGACCRLVRMGAELGHVAASGLCAVSEMLRRNNVRATAAVLARRPPTELLVRALLTSERWGHVFKRSEAALLCVQELALRGEGARLLAERALADYATVVRACEQEIASMRAVRCHTDATLLDVLRAAHDAKALFVSNAFLERAAEFPIYGTALFGKVCMMRLRVSLAEQIAGLMCPCALPPEIVTSILCFLPYESLLDLRRAMLTRP C2E50A0018D1A60C q6tvj1_orfsa protein protein orfsa orfsa OV-SA00 Orf virus-San Angelo 2000 MDAAEMEELDINAESVLYDYFILNADRARVGEVVMLLAQGAEINYADSFDKTPLHLYLHTRHPRSDVILALMEAGAVVDTPERCCGSTAAHLYILNASEVDLSVLEAMLTWGVRQNNPHSERLLSSLLHECAVNRAYSGQTEPIMDLLIGMGADVNMPGGVRRTALHACLTGLNTNPCMIRALLRRGASVTATDTYDMTPLAVLLESARATPELVRILVEAGSDVSATDFSLNSMLHHHAQSTRPRASVMRELIRLGCSPVAKNMFGNTPMHTLAMGSSCRRSIILPLLEAGVSVNEENLDYGTVPLHVAAGYNNTRGCLKLLRQGGDPAVVSAAGRTPISNMLVKRNHVAVAGALSTHPSAAVVAQALEHALDAGPSEASRLAVAFVVARAGASALPEAVRRLHEGFVADCEREVALLSHTMLGTPAVSALVVLVSKEVFGTVISSRALRVVREVRVYARPLREALINLRHKCRLVSSLKRQVGPCSLPGELVERVLATVPLADLSRSCDRRAPE C5EC439F58A69661 cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA q13309-1 S-phase kinase-associated protein 2 Cyclin-A/CDK2-associated protein p45 F-box protein Skp2 F-box/LRR-repeat protein 1 p45skp2 SKP2-alpha SKP2 FBXL1 protein protein human Homo sapiens Human MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL DIP protein Q13309-1 original sequence version: 154 DIP protein Q13309-1 original sequence version: 104 DIP protein Q13309 original sequence version: 105 DIP protein Q13309 original sequence version: 153 DIP protein Q13309 original sequence version: 151 q6tvj4_orfsa protein protein orfsa orfsa OV-SA00 Orf virus-San Angelo 2000 MADERGPDGALFRYLESEERPDVERMRRLLDEGADVNYAGPRGYAPLHMLMRGNPLDPDAVRLLLAAGADVNATSLCGFTPLHSYMCFGTVTPDTLCALMRHGARVSDLERNINALIEYFNRNGCMGGAEAAVIALLVEHGAYVNAKDDLGRTPLHIYLSGFFVSAPVALALIALGANPNATDAYGRTPLHAFLRSRDVDPAVLKTLIAAGADPLARDIIRRTALHYHCESFKTRASVIETLVAAGCDPASTDLLDNTALHSMAMGSSCRASLIRPLLAAGVSVNARNARLQTPLHLAAVFNPPACARLLAAGADPALSDLDETTPLLSMVRHNCARAVRTALPLAPDALVAGAVNRVNARTPSAATRECVMALALRGALDLLSAESARAHAAAIRACEAEVALLRRTRLGAPPTTLFSLLTGRPNTLISAKAARRAMADVCVYRAALAARVERVRRKSSLVERLTAMVCPCALPPELVTRILALLTVEELACAMRK A8BB285807D5EE14 orf129-cul1-1 4 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf008-skp1-1 1 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 487-516 Region 487-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association orf126-cul1-1 19 31 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf123-cul1-1 13 24 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf008-cul1-1 20 24 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role bait bait Region 487-516 Region 487-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association orf008-cul1-2 2 24 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait Region 487-516 Region 487-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association orf129-cul1-2 10 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf123-cul1-2 6 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf123-skp1-1 16 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association skp1-orf008-1 15 24 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 487-516 Region 487-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association orf126-cul1-2 18 31 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf128-cul1-1 17 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association cul1-orf008-1 3 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role prey prey Region 487-516 Region 487-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association orf008-cul1-3 9 23 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role bait bait Region 487-516 Region 487-516 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association orf126-skp1-1 12 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 31 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association orf128-cul1-2 8 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association orf129-cand1-1 14 26 unspecified role unspecified role prey prey human Homo sapiens Human 28 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role prey prey human Homo sapiens Human association association skp2-cul1-1 11 30 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association orf008-cul1-4 5 23 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association orf128-skp1-1 7 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 22 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association skp2-cul1-2 21 30 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association 1 nodeMerge04 2013-09-28