DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lázár-Molnár E., Yan Q., Cao E., Ramagopal U., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lázár-Molnár E., Yan Q., Cao E., Ramagopal U., Nathenson SG., Almo SC. DIP original experiment: DIP-111242X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lázár-Molnár E., Yan Q., Cao E., Ramagopal U., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lázár-Molnár E., Yan Q., Cao E., Ramagopal U., Nathenson SG., Almo SC. DIP original experiment: DIP-111241X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lázár-Molnár E., Yan Q., Cao E., Ramagopal U., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lázár-Molnár E., Yan Q., Cao E., Ramagopal U., Nathenson SG., Almo SC. DIP original experiment: DIP-111240X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the complex between programmed death-1 (PD-1) and its ligand PD-L2. pd1l2_mouse Programmed cell death 1 ligand 2 Pdcd1lg2 B7dc Btdc Cd273 Pdl2 Butyrophilin B7-DC protein protein mouse Mus musculus Mouse MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI DIP protein Q9WUL5 original sequence version: 51 pd1l1_mouse Programmed cell death 1 ligand 1 Cd274 B7h1 Pdcd1l1 Pdcd1lg1 Pdl1 B7 homolog 1 protein protein mouse Mus musculus Mouse MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKEDEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIISYGGADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSVTTSRTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQNHTAELIIPELPATHPPQNRTHWVLLGSILLFLIVVSTVLLFLRKQVRMLDVEKCGVEDTSSKNRNDTQFEET DIP protein Q9EP73 original sequence version: 51 AB7C46CF853EBB02 pdcd1_mouse Programmed cell death protein 1 Pdcd1 Pd1 protein protein mouse Mus musculus Mouse MWVRQVPWSFTWAVLQLSWQSGWLLEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQGMVIGIMSALVGIPVLLLLAWALAVFCSTSMSEARGAGSKDDTLKEEPSAAPVPSVAYEELDFQGREKTPELPTACVHTEYATIVFTEGLGASAMGRRGSADGLQGPRPPRHEDGHCSWPL DIP protein Q02242 original sequence version: 72 DIP protein Q02242 original sequence version: 75 4AD3C5F0F9D4200A cd274-pdcd1-3 1 5 unspecified role unspecified role bait bait Region 19-239 Region 19-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 6 unspecified role unspecified role prey prey Region 34-150 Region 34-150 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction pdcd1-pdcd1lg2-1 3 4 unspecified role unspecified role unspecified role unspecified role Region 20-220 Region 20-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 34-150 Region 34-150 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd1lg2-pdcd1-1 2 4 unspecified role unspecified role bait bait Region 20-220 Region 20-220 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 6 unspecified role unspecified role prey prey Region 34-150 Region 34-150 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction