DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Par3/Par6 polarity complex coordinates apical ectoplasmic specialization and blood-testis barrier restructuring during spermatogenesis. Par3/Par6 polarity complex coordinates apical ectoplasmic specialization and blood-testis barrier restructuring during spermatogenesis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wong EW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wong EW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-111232X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.4 Par3/Par6 polarity complex coordinates apical ectoplasmic specialization and blood-testis barrier restructuring during spermatogenesis. Par3/Par6 polarity complex coordinates apical ectoplasmic specialization and blood-testis barrier restructuring during spermatogenesis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wong EW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wong EW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-111231X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.4 Par3/Par6 polarity complex coordinates apical ectoplasmic specialization and blood-testis barrier restructuring during spermatogenesis. Par3/Par6 polarity complex coordinates apical ectoplasmic specialization and blood-testis barrier restructuring during spermatogenesis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wong EW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wong EW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-111230X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.4 jam3_rat Junctional adhesion molecule C Jam3 Junctional adhesion molecule 3 protein protein rat Rattus norvegicus (Rat) Rat MALSRRLRLRLCARLPDFFLLLLFRGCVIEAVNLKSSNRNPVVHEFESVELSCIITDSQTNDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDELTIELIVQVKPVAPVCRVPKAVPVGKAATLQCQESEGYPRPYYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFSAVHKEDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGESYKSPGKHEGVNYIRTSEEGDFRHKSSFVI DIP protein Q68FQ2 original sequence version: 41 par6a_rat Partitioning defective 6 homolog alpha Pard6a Par-6a Par6a protein protein rat Rattus norvegicus (Rat) Rat MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEGDSSGLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDNSDPVIENRHPPCSNGLSQGPLCWDLQPGCLHPSAGSSLPSLDSREQANSGWGNGMRGDVSGFSL not sure about protein subtype, an alpha form was given by me DIP protein Q6B4M5 original sequence version: 40 E363D7F8960DEF7F src_rat Proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein rat Rattus norvegicus (Rat) Rat MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein Q9WUD9 original sequence version: 74 DIP protein Q9WUD9 original sequence version: 94 mint homomint 453D1E904EC660A3 pals1_rat Protein PALS1 Pals1 MAGUK p55 subfamily member 5 Mpp5 Protein associated with Lin-7 1 protein protein rat Rattus norvegicus (Rat) Rat MTTSYMNGHVTEESDSGIKNLGLASPEEHPKHREMAVDCPGDLGTRLMPVRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVKILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVTVHMNKASPPFPLIANVQDLVQEVQTVLKPVHQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPITDERVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRAQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR 7F212741A8454B14 jam3-pals1-1 3 7 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 4 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association src-pals1-1 2 6 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 7 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association pard6a-pals1-1 1 7 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 5 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association