DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250348X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250346X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250345X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250351X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250349X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250350X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. Nature 2008 imex curation Gong Y., Cao P., Yu HJ., Jiang T. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gong Y., Cao P., Yu HJ., Jiang T. DIP original experiment: DIP-250347X Nature 2008 IMEx Crystal structure of the neurotrophin-3 and p75NTR symmetrical complex. ngf_mouse Beta-nerve growth factor Ngf Ngfb protein protein mouse Mus musculus Mouse MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIAARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSKRSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG DIP protein P01139 original sequence version: 121 164465E1DC550081 ngf_human Beta-nerve growth factor NGF NGFB protein protein human Homo sapiens Human MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA DIP protein P01138 original sequence version: 170 DIP protein P01138 original sequence version: 144 DIP protein P01138 original sequence version: 121 DIP protein P01138 original sequence version: 172 619DFC65EB3BD671 tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV DIP protein P07174 original sequence version: 124 DIP protein P07174 original sequence version: 106 B2E152D94D3827F8 ntf3_human Neurotrophin-3 Neurotrophic factor HDNF Nerve growth factor 2 NTF3 protein protein human Homo sapiens Human MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT DIP protein P20783 original sequence version: 133 39A5BB3B28E25E03 ngf-ngfr-1 6 10 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ngfr-6 3 10 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ntf3-ngfr-1 1 10 unspecified role unspecified role prey prey Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction ngfr-ntf3-1 2 10 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ngfr-ntf3-2 5 10 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ngf-ngfr-2 4 8 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 10 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ngfr-ntf3-3 7 10 unspecified role unspecified role unspecified role unspecified role Region 1-161 Region 1-161 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction