DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of human thymine DNA glycosylase bound to DNA elucidates sequence-specific mismatch recognition. Crystal structure of human thymine DNA glycosylase bound to DNA elucidates sequence-specific mismatch recognition. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Maiti A., Morgan MT., Pozharski E., Drohat AC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Maiti A., Morgan MT., Pozharski E., Drohat AC. DIP original experiment: DIP-111183X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of human thymine DNA glycosylase bound to DNA elucidates sequence-specific mismatch recognition. tdg_human G/T mismatch-specific thymine DNA glycosylase TDG Thymine-DNA glycosylase protein protein human Homo sapiens Human MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA DIP protein Q13569 original sequence version: 70 DIP protein Q13569 original sequence version: 99 33752B26EBC789AE tdg-1 1 2 unspecified role unspecified role unspecified role unspecified role Region 111-308 Region 111-308 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction