DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111125X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel monoclonal western monoclonal antibody western blot monoclonal western Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111124X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111123X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liang S., Ristich V., Arase H., Dausset J., Carosella ED., Horuzsko A. DIP original experiment: DIP-111126X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Modulation of dendritic cell differentiation by HLA-G and ILT4 requires the IL-6--STAT3 signaling pathway. hlag_human HLA class I histocompatibility antigen, alpha chain G HLAG HLA-G HLA-6.0 HLA G antigen MHC class I antigen G protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD DIP protein P17693 original sequence version: 150 DIP protein P17693 original sequence version: 89 0678E263BE8962FF ptn6_mouse Tyrosine-protein phosphatase non-receptor type 6 Ptpn6 Hcp Hcph Ptp1C Protein-tyrosine phosphatase 1C Hematopoietic cell protein-tyrosine phosphatase 70Z-SHP SH-PTP1 PTPTY-42 protein protein mouse Mus musculus Mouse MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNITYPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK DIP protein P29351 original sequence version: 154 DIP protein P29351 original sequence version: 102 DIP protein P29351 original sequence version: 117 DIP protein P29351 original sequence version: 164 DIP protein P29351 original sequence version: 134 CF17300D032638D2 lirb4_mouse Leukocyte immunoglobulin-like receptor subfamily B member 4 Lilrb4 Gp49b Mast cell surface glycoprotein Gp49B protein protein mouse Mus musculus Mouse MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS DIP protein Q64281 original sequence version: 74 ptn11_mouse Tyrosine-protein phosphatase non-receptor type 11 Ptpn11 Protein-tyrosine phosphatase SYP SH-PTP2 protein protein mouse Mus musculus Mouse MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR DIP protein P35235 original sequence version: 93 DIP protein P35235 original sequence version: 99 DIP protein P35235 original sequence version: 138 6C71EEEECCF7F159 hla_g-9 3 5 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction hla_g-10 2 5 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction lilrb4-ptpn6-4 1 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association lilrb4-ptpn11-1 4 8 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association