DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Bcl-XL inhibits membrane permeabilization by competing with Bax. Bcl-XL inhibits membrane permeabilization by competing with Bax. PLoS biology 2008 imex curation Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. DIP original experiment: DIP-110850X PLoS biology 2008 IMEx Bcl-XL inhibits membrane permeabilization by competing with Bax. Bcl-XL inhibits membrane permeabilization by competing with Bax. Bcl-XL inhibits membrane permeabilization by competing with Bax. PLoS biology 2008 imex curation Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. DIP original experiment: DIP-110852X PLoS biology 2008 IMEx Bcl-XL inhibits membrane permeabilization by competing with Bax. Bcl-XL inhibits membrane permeabilization by competing with Bax. Bcl-XL inhibits membrane permeabilization by competing with Bax. PLoS biology 2008 imex curation Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Billen LP., Kokoski CL., Lovell JF., Leber B., Andrews DW. DIP original experiment: DIP-110851X PLoS biology 2008 IMEx Bcl-XL inhibits membrane permeabilization by competing with Bax. q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 bax-8 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction bcl2l1-bax-6 3 6 unspecified role unspecified role prey prey ecolx Escherichia coli 4 unspecified role unspecified role bait bait Region 4-24 Region 4-24 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q07817-1:p.Tyr101Lys Y101K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y K This feature has been corrected as a result of our quality control procedures. The original label was 'Y101K'. Wed May 02 15:19:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr101lys' Tue Jun 30 18:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr101Lys' ecolx Escherichia coli direct interaction direct interaction bcl2l1-bid-2 2 5 unspecified role unspecified role prey prey P70444:p.[Met97Ala;Asp98Ala] M97A/D98A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain M A This feature has been corrected as a result of our quality control procedures. The original label was 'M97A/D98A'. Wed May 02 20:13:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met97ala,asp98ala' Tue Jun 30 16:15:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met97Ala;Asp98Ala]' ecolx Escherichia coli 4 unspecified role unspecified role bait bait Region 4-24 Region 4-24 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction