DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68558X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68565X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68550X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68561X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68567X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68564X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68549X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68553X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68559X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68551X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68552X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68557X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68560X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68556X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68563X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68555X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68566X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68562X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. PLoS biology 2008 imex curation Süel KE., Gu H., Chook YM. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Süel KE., Gu H., Chook YM. DIP original experiment: DIP-68554X PLoS biology 2008 IMEx Modular organization and combinatorial energetics of proline-tyrosine nuclear localization signals. ssbp1_yeast Single-stranded nucleic acid-binding protein YHL034C SBP1 SSBR1 SSB1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAEIEEATNAVNNLSINDSEQQPRAPTHKTVIDPEDTIFIGNVAHECTEDDLKQLFVEEFGDEVSVEIPIKEHTDGHIPASKHALVKFPTKIDFDNIKENYDTKVVKDREIHIKRARTPGQMQRGGFRGRGGFRGRGGFRGGFRGGYRGGFRGRGNFRGRGGARGGFNGQKREKIPLDQMERSKDTLYINNVPFKATKEEVAEFFGTDADSISLPMRKMRDQHTGRIFTSDSANRGMAFVTFSGENVDIEAKAEEFKGKVFGDRELTVDVAVIRPENDEEEIEQETGSEEKQE FF740B206DDE5EC8 FF740B206DDE5EC8 tnpo1_human Transportin-1 TRN TNPO1 KPNB2 MIP1 Importin beta-2 Karyopherin beta-2 M9 region interaction protein protein protein human Homo sapiens Human MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV DIP protein Q92973 original sequence version: 77 DIP protein Q92973 original sequence version: 89 7B880D9E7CA6798F naf1_yeast H/ACA ribonucleoprotein complex non-core subunit NAF1 YNL124W N1888 NAF1 Nuclear assembly factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDDLFSKALENPDQDLNVELPKDDVDLGLLGDGGNERKTDEPVADAERSTGLGSGSSESESDSGSDSDSDSGSSGSEDDSADQDVEGEDEGGDAIENEDEDEDPSPSGPILSKNEILEETVPELPEDYEISEKTIITPIGVLKSAFENNIIIHATMSGEKRVLKEGSIFCLEDRTLIGMLTEVFGPLQNPFYRIKLPDSKKNLFDELKVRLGEKAFIVTPDAHWIDTFELKRNKGTDASNGYDEELPEEEQEFSDDEKEALFKKMKKQQRQRKKRDNRKLANDSDNVKVKRARQPKANSLPKLVPPLGMSSNAPMQHGYKSRNARENIKRESSATSNRNGSSPVPITQHHQQQFSANNYPFPQQPNGMPYPPYSPFPQPTNFQYPPPPFGQATPAQFSNTVPYGSLPPAYNNMSPPTQQSFMPMTQSQPPLPYGVPPMNQMQNPMYIQPPPQAPPQGNGNFQQVMELHQILLQQQQQQHQYQHQHQQDPRT 5A496278070F6255 5A496278070F6255 fus_human RNA-binding protein FUS FUS TLS Oncogene FUS Oncogene TLS Translocated in liposarcoma protein POMp75 75 kDa DNA-pairing protein protein protein human Homo sapiens Human MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY DIP protein P35637 original sequence version: 165 DIP protein P35637 original sequence version: 156 DIP protein P35637-1 original sequence version: 156 DIP protein P35637-1 original sequence version: 92 DIP protein P35637-1 original sequence version: 146 88C8E263B7905549 ru17_yeast U1 small nuclear ribonucleoprotein 70 kDa homolog YIL061C SNP1 U1 small nuclear ribonucleoprotein SNP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNYNLSKYPDDVSRLFKPRPPLSYKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEEFPEGSPNNHLQRYEDIKLSKIKNAQLLDRRLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDIERGRTVKYFKPRRLGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPRLPRRETSSSAYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSVYKSRNSRTRESQPAPKEAPDY 7D9E47BE66FE1EB8 7D9E47BE66FE1EB8 ste20_yeast Serine/threonine-protein kinase STE20 STE20 YHL007C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNDPSAVSELPDKDSLDNGISNDNERAMGGNGDGGDGLRLPRTTGTLNVNALQKGTNAAHEAGGYKSMDPAKNAETTNDDDNNVVSLDDPIQFTRVSSSSVISGMSSSMSPHSNIDETKSLEAVTPNINTSNITPDHSADNTFSTINASESDHQFNDTLLSKLSLTDSTETIENNATVKHQQPVASSTVNSNKSSTDIRRATPVSTPVISKPSMTTTPRQINSASHSLSNPKHKQHKPKVKPSKPEAKSKPVSVKKSFPSKNPLKNSSPPKKQTEKSYYSSSSKKRKSGSNSGTLRMKDVFTSFVQNIKRNSQDDKRASSSSNNSSSSSITTALRISTPYNAKHIHHVGVDSKTGEYTGLPEEWEKLLTSSGISKREQQQNMQAVMDIVKFYQDVTETNGEDKMFKTFNTTTGLPGSPQVSTPPANSFNKFPPSTSDSHNYGSRTGTPMSNHVMSPTLNTDSSSANGKFIPSRPAPKPPSSASASAPIIKSPVMNSAANVSPLKQTHAPTTPNRTSPNRSSISRNATLKKEEQPLPPIPPTKSKTSPIISTAHTPQQVAQSPKAPAQETVTTPTSKPAQARSLSKELNEKKREERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLARLKKVAENMDADEDNDDDNDNEHINKTNNCDDNNDSKETVNLDVTEDDKQK 69C1C12F5B87733C 69C1C12F5B87733C imb2_yeast Importin subunit beta-2 KAP104 YBR017C YBR0224 Karyopherin subunit beta-2 Karyopherin-104 Importin-104 Transportin protein protein yeast Saccharomyces cerevisiae Baker's yeast MASTWKPAEDYVLQLATLLQNCMSPNPEIRNNAMEAMENFQLQPEFLNYLCYILIEGESDDVLKQHYSLQDLQNNRATAGMLLKNSMLGGNNLIKSNSHDLGYVKSNIIHGLYNSNNNLVSNVTGIVITTLFSTYYRQHRDDPTGLQMLYQLLELTSNGNEPSIKALSKIMEDSAQFFQLEWSGNTKPMEALLDSFFRFISNPNFSPVIRSESVKCINTVIPLQTQSFIVRLDKFLEIIFQLAQNDENDLVRAQICISFSFLLEFRPDKLVSHLDGIVQFMLHLITTVNEEKVAIEACEFLHAFATSPNIPEHILQPYVKDIVPILLSKMVYNEESIVLLEASNDDDAFLEDKDEDIKPIAPRIVKKKEAGNGEDADDNEDDDDDDDDEDGDVDTQWNLRKCSAATLDVMTNILPHQVMDIAFPFLREHLGSDRWFIREATILALGAMAEGGMKYFNDGLPALIPFLVEQLNDKWAPVRKMTCWTLSRFSPWILQDHTEFLIPVLEPIINTLMDKKKDVQEAAISSVAVFIENADSELVETLFYSQLLTSFDKCLKYYKKKNLIILYDAIGRFAEKCALDETAMQIILPPLIEKWALLSDSDKELWPLLECLSCVASSLGERFMPMAPEVYNRAFRILCHCVELEAKSHQDPTIVVPEKDFIITSLDLIDGLVQGLGAHSQDLLFPQGTKDLTILKIMLECLQDPVHEVRQSCFALLGDIVYFFNSELVIGNLEDFLKLIGTEIMHNDDSDGTPAVINAIWALGLISERIDLNTYIIDMSRIILDLFTTNTQIVDSSVMENLSVTIGKMGLTHPEVFSSGAFANDSNWNKWCLSVNALDDVEEKSSAYMGFLKIINLTSTEVTMSNDTIHKIVTGLSSNVEANVFAQEIYTFLMNHSAQISAINFTPDEISFLQQFTS E8010A477D1FC0B5 E8010A477D1FC0B5 t2fb_yeast Transcription initiation factor IIF subunit beta YGR005C TFG2 TFIIF-beta TFIIF medium subunit Transcription factor G 54 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSGSAGAPALSNNSTNSVAKEKSGNISGDEYLSQEEEVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINKDGSKITLLLNENDNDSIPHEYDLELTKKVVENEYVFTEQNLKKYQQRKKELEADPEKQRQAYLKKQEREEELKKKQQQQKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTLRPEYKKLKEEERKATLGELADEQTGSAGDNAQGDAEADLEDEIEMEDVV DDDA895446BBF26F DDDA895446BBF26F nab2_yeast Nuclear polyadenylated RNA-binding protein NAB2 YGL122C NAB2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIAQQQQQQQQQQQPDIAQQQPQQQPQQQPQQQPQQQPQQQPQQQPQQQPQQQPQLQPLQPQLGTQNAMQTDAPATPSPISAFSGVVNAAAPPQFAPVDNSQRFTQRGGGAVGKNRRGGRGGNRGGRNNNSTRFNPLAKALGMAGESNMNFTPTKKEGRCRLFPHCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEFLHPNEDEELMKEMERTREEFQKRKADLLAAKRKPVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQKKAAPPPVEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVLPEKKGAAPNSNVPTNERPFALPENAIIENAPPQTSFTHQEQDTEMN 40335C3D4658DD91 40335C3D4658DD91 hrp1_yeast Nuclear polyadenylated RNA-binding protein 4 YOL123W HRP1 NAB4 NAB5 Cleavage factor IB protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSDEEDFNDIYGDDKPTTTEEVKKEEEQNKAGSGTSQLDQLAALQALSSSLNKLNNPNSNNSSSNNSNQDTSSSKQDGTANDKEGSNEDTKNEKKQESATSANANANASSAGPSGLPWEQLQQTMSQFQQPSSQSPPQQQVTQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRHMQQKSSNNGGNNGGNNMNRRGGNFGNQGDFNQMYQNPMMGGYNPMMNPQAMTDYYQKMQEYYQQMQKQTGMDYTQMYQQQMQQMAMMMPGFAMPPNAMTLNQPQQDSNATQGSPAPSDSDNNKSNDVQTIGNTSNTDSGSPPLNLPNGPKGPSQYNDDHNSGYGYNRDRGDRDRNDRDRDYNHRSGGNHRRNGRGGRGGYNRRNNGYHPYNR 1B231069437B093D 1B231069437B093D hnrpm_human Heterogeneous nuclear ribonucleoprotein M HNRNPM HNRPM NAGR1 protein protein human Homo sapiens Human MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMITIPPSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPIDANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIERMGPLGLDHMASSIERMGQTMERIGSGVERMGAGMGFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRNA DIP protein P52272 original sequence version: 71 DIP protein P52272 original sequence version: 86 1A73DD35A3501861 rml2_yeast 54S ribosomal protein RML2, mitochondrial RML2 Mitochondrial large ribosomal subunit protein uL2m SYGP-ORF37 YEL050C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLVLGSLRSALSCSSTASLISKRNPCYPYGILCRTLSQSVKLWQENTSKDDSSLNITPRLLKIIPNDTDIVTLEKQDELIKRRRKLSKEVTQMKRLKPVSPGLRWYRSPIYPYLYKGRPVRALTVVRKKHGGRNNSGKITVRHQGGGHRNRTRLIDFNRWEGGAQTVQRIEYDPGRSSHIALLKHNTTGELSYIIACDGLRPGDVVESFRRGIPQTLLNEMGGKVDPAILSVKTTQRGNCLPISMIPIGTIIHNVGITPVGPGKFCRSAGTYARVLAKLPEKKKAIVRLQSGEHRYVSLEAVATIGVVSNIDHQNRSLGKAGRSRWLGIRPTVRGVAMNKCDHPHGGGRGKSKSNKLSMSPWGQLAKGYKTRRGKNQNRMKVKDRPRGKDARL 6AD955FF61C24923 6AD955FF61C24923 enp1_yeast Essential nuclear protein 1 ENP1 MEG1 YBR247C YBR1635 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARASSTKARKQRHDPLLKDLDAAQGTLKKINKKKLAQNDAANHDAANEEDGYIDSKASRKILQLAKEQQDEIEGEELAESERNKQFEARFTTMSYDDEDEDEDEDEEAFGEDISDFEPEGDYKEEEEIVEIDEEDAAMFEQYFKKSDDFNSLSGSYNLADKIMASIREKESQVEDMQDDEPLANEQNTSRGNISSGLKSGEGVALPEKVIKAYTTVGSILKTWTHGKLPKLFKVIPSLRNWQDVIYVTNPEEWSPHVVYEATKLFVSNLTAKESQKFINLILLERFRDNIETSEDHSLNYHIYRAVKKSLYKPSAFFKGFLFPLVETGCNVREATIAGSVLAKVSVPALHSSAALSYLLRLPFSPPTTVFIKILLDKKYALPYQTVDDCVYYFMRFRILDDGSNGEDATRVLPVIWHKAFLTFAQRYKNDITQDQRDFLLETVRQRGHKDIGPEIRRELLAGASREFVDPQEANDDLMIDVN 399A415131294637 399A415131294637 arp8_yeast Actin-like protein ARP8 ARP8 YOR3348C YOR141C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQEEAESSIIYEEPIDIPLEDDDDEDELEEENSVPLSSQADQENAENESDDSVDNVVGSETPRSVTGLSVDPRDVADEEDEDEEGEDEDEDEDDNDVDNEDENDNDNANENENELGSSRDKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDVIDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 8174851B6B077A19 8174851B6B077A19 dig1_yeast Down-regulator of invasive growth 1 DIG1 Regulator of sterile twelve 1 Regulator of STE12 protein 1 RST1 P7102.02 YPL049C protein protein yeast Saccharomyces cerevisiae Baker's yeast MAVSARLRTTAEDTSIAKSTQDPIGDTEISVANAKGSSDSNIKNSPGGNSVGQESELEHVPEEDDSGDKEADHEDSETATAKKRKAQPLKNPKKSLKRGRVPAPLNLSDSNTNTHGGNIKDGNLASSNSAHFPPVANQNVKSAPAQVTQHSKFQPRVQYLGKASSRQSIQVNNSSNSYGKPHMPSAGIMSAMNPYMPMNRYIMSPYYNPYGIPPPHMLNKPIMTPYVSYPYPMGPRTSIPYAMQGGNARPYEENEYSASNYRNKRVNDSYDSPLSGTASTGKTRRSEEGSRNSSVGSSANAGPTQQRADLRPADMIPAEEYHFERDALLSANTKARSASTSTSTSTSTNRDRSSWHEAEPNKDEEEGTDLAIEDGAVPTPTFTTFQRTSQPQQQSPSLLQGEIRLSSHIFAFEFPLSSSNVDKKMFMSICNKVWNESKELTKKSSSHHRTGK 2D27F9878BFADD30 2D27F9878BFADD30 prtb_yeast Cerevisin YEL060C PRB1 Vacuolar protease B Proteinase YSCB protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTKDDDEEPSDSEDKEHGKFHKKGRKGQDKESPEFNGKRASGSHGSAHEGGKGMKPKHESSNDDDNDDKKKKPHHKGGCHENKVEEKKMKGKKVKGKKHHEKTLEKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII C346C2B1C7DDDC48 C346C2B1C7DDDC48 cdc25_yeast Cell division control protein 25 CDC25 CTN1 YLR310C L2142.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDTNTSIPNTSSAREAGNASQTPSISSSSNTSTTTNTESSSASLSSSPSTSELTSIRPIGIVVAAYDFNYPIKKDSSSQLLSVQQGETIYILNKNSSGWWDGLVIDDSNGKVNRGWFPQNFGRPLRDSHLRKHSHPMKKYSSSKSSRRSSLNSLGNSAYLHVPRNPSKSRRGSSTLSASLSNAHNAETSSGHNNTVSMNNSPFSAPNDASHITPQSSNFNSNASLSQDMTKSADGSSEMNTNAIMNNNETNLQTSGEKAGPPLVAEETIKILPLEEIEMIINGIRSNIASTWSPIPLITKTSDYKLVYYNKDLDIYCSELPLISNSIMESDDICDSEPKFPPNDHLVNLYTRDLRKNANIEDSSTRSKQSESEQNRSSLLMEKQDSKETDGNNNSINDDDNNNENNKNEFNEAGPSSLNSLSAPDLTQNIQSRVVAPSRSSILAKSDIFYHYSRDIKLWTELQDLTVYYTKTAHKMFLKENRLNFTKYFDLISDSIVFTQLGCRLMQHEIKAKSCSKEIKKIFKGLISSLSRISINSHLYFDSAFHRKKMDTMNDKDNDNQENNCSRTEGDDGKIEVDSVHDLVSVPLSGKRNVSTSTTDTLTPMRSSFSTVNENDMENFSVLGPRNSVNSVVTPRTSIQNSTLEDFSPSNKNFKSAKSIYEMVDVEFSKFLRHVQLLYFVLQSSVFSDDNTLPQLLPRFFKGSFSGGSWTNPFSTFITDEFGNATKNKAVTSNEVTASSSKNSSISRIPPKMADAIASASGYSANSETNSQIDLKASSAASGSVFTPFNRPSHNRTFSRARVSKRKKKYPLTVDTLNTMKKKSSQIFEKLNNATGEHLKIISKPKSRIRNLEINSSTYEQINQNVLLLEILENLDLSIFINLKNLIKTPSILLDLESEEFLVHAMSSVSSVLTEFFDIKQAFHDIVIRLIMTTQQTTLDDPYLFSSMRSNFPVGHHEPFKNISNTPLVKGPFHKKNEQLALSLFHVLVSQDVEFNNLEFLNNSDDFKDACEKYVEISNLACIIVDQLIEERENLLNYAARMMKNNLTAELLKGEQEKWFDIYSEDYSDDDSENDEAIIDDELGSEDYIERKAANIEKNLPWFLTSDYETSLVYDSRGKIRGGTKEALIEHLTSHELVDAAFNVTMLITFRSILTTREFFYALIYRYNLYPPEGLSYDDYNIWIEKKSNPIKCRVVNIMRTFLTQYWTRNYYEPGIPLILNFAKMVVSEKIPGAEDLLQKINEKLINENEKEPVDPKQQDSVSAVVQTTKRDNKSPIHMSSSSLPSSASSAFFRLKKLKLLDIDPYTYATQLTVLEHDLYLRITMFECLDRAWGTKYCNMGGSPNITKFIANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIYRLKKTWDLVSTESKDLLKNLNNLMDSKRNFVKYRELLRSVTDVACVPFFGVYLSDLTFTFVGNPDFLHNSTNIINFSKRTKIANIVEEIISFKRFHYKLKRLDDIQTVIEASLENVPHIEKQYQLSLQVEPRSGNTKGSTHASSASGTKTAKFLSEFTDDKNGNFLKLGKKKPPSRLFR CA90053435C85465 CA90053435C85465 hrp1p-kap104p-1 17 29 unspecified role unspecified role unspecified role unspecified role Region 494-534 Region 494-534 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q99383:p.[Arg512_Arg513delinsAlaAla;Arg516Ala;Arg519Ala] R512/R513/R516/R519A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain RR AA Fri Jul 28 10:52:30 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg512-513ala_ala,argR516ala,arg519ala' Wed May 02 18:53:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg512-513ala_ala,arg516ala,arg519ala' Tue Jun 30 16:39:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg512_Arg513delinsAlaAla;Arg516Ala;Arg519Ala]' Q99383:p.Tyr529Ala Y529A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y529A'. Wed May 02 15:53:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr529ala' Tue Jun 30 19:56:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr529Ala' Q99383:p.Tyr532Phe Y532F/H/M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:05:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr532phe' Tue Jun 30 19:27:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr532Phe' Q99383:p.Tyr532His mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y H Wed May 02 17:27:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr532his' Tue Jun 30 19:17:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr532His' Q99383:p.Tyr532Met mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y M Wed May 02 19:27:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr532met' Tue Jun 30 17:55:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr532Met' ecolx Escherichia coli 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hrp1p-kap104p-2 7 29 unspecified role unspecified role bait bait Region 494-534 Region 494-534 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction hrp1p-tnpo1-1 8 21 unspecified role unspecified role prey prey ecolx Escherichia coli 29 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 494-534 Region 494-534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snp1p-kap104p-1 12 24 unspecified role unspecified role bait bait Region 1-42 Region 1-42 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction cdc25p-kap104p-1 4 36 unspecified role unspecified role bait bait Region 774-823 Region 774-823 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction ste20p-kap104p-1 2 25 unspecified role unspecified role bait bait Region 226-275 Region 226-275 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction nab2p-kap104p-1 3 28 unspecified role unspecified role bait bait Region 201-251 Region 201-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction nab2p-tnpo1-1 19 21 unspecified role unspecified role prey prey ecolx Escherichia coli 28 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 201-251 Region 201-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction naf1p-kap104p-1 1 22 unspecified role unspecified role bait bait Region 269-318 Region 269-318 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction sbp1p-kap104p-1 18 20 unspecified role unspecified role bait bait Region 138-187 Region 138-187 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction hnrnpm-kap104p-1 10 30 unspecified role unspecified role bait bait Region 41-70 Region 41-70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction tfg2p-kap104p-1 16 27 unspecified role unspecified role bait bait Region 165-214 Region 165-214 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction prb1p-kap104p-1 9 35 unspecified role unspecified role bait bait Region 125-174 Region 125-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction dig1p-kap104p-1 15 34 unspecified role unspecified role bait bait Region 66-115 Region 66-115 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction fus-kap104p-1 11 23 unspecified role unspecified role bait bait Region 476-526 Region 476-526 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction rml2p-kap104p-1 14 31 unspecified role unspecified role bait bait Region 74-123 Region 74-123 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction kap104p-nab2p-1 5 28 unspecified role unspecified role unspecified role unspecified role Region 201-251 Region 201-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P32505:p.[Lys216Ala;Asn217Ala;Arg218Ala;Arg219Ala] K216A/N217A/R218A/R219A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K216A/N217A/R218A/R219A'. Wed May 02 16:48:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys216ala,asn217ala,arg218ala,arg219ala' Tue Jun 30 16:21:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys216Ala;Asn217Ala;Arg218Ala;Arg219Ala]' P32505:p.[Arg218_Arg219delinsAlaAla;Arg222Ala;Arg226Ala;Arg229Ala] R218/R219/R222/R226/R229A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain RR AA Wed May 02 18:56:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg218-219ala_ala,arg222ala,arg226ala,arg229ala' Tue Jun 30 15:44:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg218_Arg219delinsAlaAla;Arg222Ala;Arg226Ala;Arg229Ala]' P32505:p.Arg235Ala R235A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R235A'. Wed May 02 15:23:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg235ala' Tue Jun 30 18:08:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg235Ala' P32505:p.Phe236Ala F236A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F236A'. Wed May 02 16:28:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe236ala' Tue Jun 30 20:01:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe236Ala' P32505:p.[Arg235Ala;Pro238Ala;Leu239Ala] R235A/P238A/L239A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R235A/P238A/L239A'. Wed May 02 19:07:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg235ala,pro238ala,leu239ala' Tue Jun 30 19:12:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg235Ala;Pro238Ala;Leu239Ala]' P32505:p.[Arg222Ala;Pro238Ala;Leu239Ala] R222A/P238A/L239A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R222A/P238A/L239A'. Wed May 02 16:39:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg222ala,pro238ala,leu239ala' Tue Jun 30 17:10:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg222Ala;Pro238Ala;Leu239Ala]' P32505:p.[Pro238Ala;Leu239Ala] P238A/L239A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P238A/L239A'. Wed May 02 14:44:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro238ala,leu239ala' Tue Jun 30 18:13:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro238Ala;Leu239Ala]' P32505:p.Leu239Asp L239D/E/P/I mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D Wed May 02 15:48:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu239asp' Tue Jun 30 18:06:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu239Asp' P32505:p.Leu239Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L E Wed May 02 14:59:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu239glu' Tue Jun 30 18:16:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu239Glu' P32505:p.Leu239Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:06:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu239pro' Tue Jun 30 17:18:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu239Pro' P32505:p.Leu239Ile mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L I Wed May 02 14:36:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu239ile' Tue Jun 30 19:33:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu239Ile' ecolx Escherichia coli 26 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction enp1p-kap104p-1 13 32 unspecified role unspecified role bait bait Region 1-27 Region 1-27 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction arp8p-kap104p-1 6 33 unspecified role unspecified role bait bait Region 114-163 Region 114-163 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction