DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. DIP original experiment: DIP-111084X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. DIP original experiment: DIP-111079X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. DIP original experiment: DIP-111082X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. DIP original experiment: DIP-111081X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. DIP original experiment: DIP-111080X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. ALIX-CHMP4 interactions in the human ESCRT pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McCullough J., Fisher RD., Whitby FG., Sundquist WI., Hill CP. DIP original experiment: DIP-111083X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx ALIX-CHMP4 interactions in the human ESCRT pathway. pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 chm4c_human Charged multivesicular body protein 4c CHMP4C SHAX3 Chromatin-modifying protein 4c Vacuolar protein sorting-associated protein 32-3 SNF7-3 SNF7 homolog associated with Alix 3 protein protein human Homo sapiens Human MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT DIP protein Q96CF2 original sequence version: 46 DIP protein Q96CF2 original sequence version: 102 DIP protein Q96CF2 original sequence version: 82 C18050F0A6C4C899 chm4a_human Charged multivesicular body protein 4a Chromatin-modifying protein 4a Vacuolar protein sorting-associated protein 32-1 SNF7-1 SNF7 homolog associated with Alix-2 CHMP4A C14orf123 SHAX2 CDA04 HSPC134 protein protein human Homo sapiens Human MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS DIP protein Q9BY43 original sequence version: 62 DIP protein Q9BY43 original sequence version: 98 6712BA6AAA1D7CB7 chm4b_human Charged multivesicular body protein 4b Chromatin-modifying protein 4b Vacuolar protein sorting-associated protein 32-2 SNF7-2 SNF7 homolog associated with Alix 1 CHMP4B C20orf178 SHAX1 protein protein human Homo sapiens Human MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM DIP protein Q9H444 original sequence version: 48 DIP protein Q9H444 original sequence version: 50 DIP protein Q9H444 original sequence version: 69 DIP protein Q9H444 original sequence version: 85 DIP protein Q9H444 original sequence version: 90 DB1D79DD3803CB2F chmp4c-pdcd6ip-2 4 8 unspecified role unspecified role unspecified role unspecified role Region 216-233 Region 216-233 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role Region 1-359 Region 1-359 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp4a-pdcd6ip-1 2 9 unspecified role unspecified role unspecified role unspecified role Region 205-222 Region 205-222 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role Region 1-359 Region 1-359 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp4b-pdcd6ip-2 6 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 205-224 Region 205-224 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role prey prey Region 1-359 Region 1-359 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp4a-pdcd6ip-2 3 9 unspecified role unspecified role bait bait Region 205-222 Region 205-222 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9BY43:p.Leu214Ala L214A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L214A'. Wed May 02 16:04:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu214ala' Tue Jun 30 20:16:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu214Ala' Q9BY43:p.Leu217Ala L217A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L217A'. Wed May 02 17:21:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu217ala' Tue Jun 30 16:39:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu217Ala' Q9BY43:p.Trp220Ala W220A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W220A'. Wed May 02 17:27:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp220ala' Tue Jun 30 20:03:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp220Ala' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey Region 1-359 Region 1-359 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp4b-pdcd6ip-3 5 10 unspecified role unspecified role unspecified role unspecified role Region 205-224 Region 205-224 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role unspecified role unspecified role Region 1-359 Region 1-359 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction chmp4c-pdcd6ip-3 1 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 216-233 Region 216-233 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role prey prey Region 1-359 Region 1-359 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction