DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259449X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259436X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259432X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259439X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259446X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259434X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259447X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259441X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259437X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259438X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259443X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259433X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259442X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259435X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259444X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259440X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259445X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259448X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. Nature 2008 imex curation Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Wang X., Arai S., Song X., Reichart D., Du K., Pascual G., Tempst P., Rosenfeld MG., Glass CK., Kurokawa R. DIP original experiment: DIP-259431X Nature 2008 IMEx Induced ncRNAs allosterically modify RNA-binding proteins in cis to inhibit transcription. rbp56_human TATA-binding protein-associated factor 2N TAF15 RBP56 TAF2N RNA-binding protein 56 68 kDa TATA-binding protein-associated factor protein protein human Homo sapiens Human MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY DIP protein Q92804 original sequence version: 146 73D37C171E1E2BCA cbp_mouse Histone lysine acetyltransferase CREBBP Crebbp Cbp Protein-lysine acetyltransferase CREBBP protein protein mouse Mus musculus Mouse MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHANNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTPTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRSEMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINNGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPVMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQPAMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL DIP protein P45481 original sequence version: 148 DIP protein P45481 original sequence version: 126 DIP protein P45481 original sequence version: 152 DIP protein P45481 original sequence version: 115 DIP protein P45481 original sequence version: 127 DIP protein P45481 original sequence version: 123 DIP protein P45481 original sequence version: 149 DIP protein P45481 original sequence version: 156 DIP protein P45481 original sequence version: 169 DIP protein P45481 original sequence version: 175 DIP protein P45481 original sequence version: 135 D89AF52B7BD33347 ews_human RNA-binding protein EWS EWSR1 EWS EWS oncogene Ewing sarcoma breakpoint region 1 protein protein protein human Homo sapiens Human MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY DIP protein Q01844 original sequence version: 164 0DA02CEE146720BB ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB fus_human RNA-binding protein FUS FUS TLS Oncogene FUS Oncogene TLS Translocated in liposarcoma protein POMp75 75 kDa DNA-pairing protein protein protein human Homo sapiens Human MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY DIP protein P35637 original sequence version: 165 DIP protein P35637 original sequence version: 156 DIP protein P35637-1 original sequence version: 156 DIP protein P35637-1 original sequence version: 92 DIP protein P35637-1 original sequence version: 146 88C8E263B7905549 kat5_human Histone acetyltransferase KAT5 KAT5 TIP60 HTATIP Lysine acetyltransferase 5 cPLA(2)-interacting protein Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein human Homo sapiens Human MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW DIP protein Q92993 original sequence version: 153 DIP protein Q92993 original sequence version: 155 DIP protein Q92993 original sequence version: 86 DIP protein Q92993 original sequence version: 149 DIP protein Q92993-1 original sequence version: 129 DIP protein Q92993 original sequence version: 144 DIP protein Q92993 original sequence version: 173 63724F5E10B957D5 ewsr1-ep300-1 18 22 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 23 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association crebbp-fus-1 19 24 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association ep300-fus-1 14 24 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association kat5-taf15-1 16 20 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association fus-ep300-1 2 23 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association fus-crebbp-1 11 21 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 24 unspecified role unspecified role bait bait Region 1-211 Region 1-211 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association taf15-kat5-1 7 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association crebbp-fus-2 3 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association crebbp-taf15-1 8 21 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association fus-kat5-1 15 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 24 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association fus-fus-1 9 24 unspecified role unspecified role prey prey Region 1-211 Region 1-211 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 24 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 373-526 Region 373-526 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association kat5-fus-1 12 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association crebbp-fus-3 13 21 unspecified role unspecified role bait bait Region 1892-2441 Region 1892-2441 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 24 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction crebbp-ewsr1-1 10 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association fus-ep300-2 17 23 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 24 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ep300-fus-2 6 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 24 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ewsr1-kat5-1 1 25 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association kat5-ewsr1-1 4 25 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 22 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association taf15-ep300-1 5 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 23 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association