DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-217488X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-217487X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111059X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111057X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111056X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111062X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111052X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111060X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111061X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111054X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111063X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111064X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111058X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111055X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ao A., Wang H., Kamarajugadda S., Lu J. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ao A., Wang H., Kamarajugadda S., Lu J. DIP original experiment: DIP-111053X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Involvement of estrogen-related receptors in transcriptional response to hypoxia and growth of solid tumors. hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D p62509-1 Estrogen-related receptor gamma Esrrg Err3 Kiaa0832 Nr3b3 Estrogen receptor-related protein 3 Nuclear receptor subfamily 3 group B member 3 Long protein protein mouse Mus musculus Mouse MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV DIP protein P62509-1 original sequence version: 54 epas1_mouse Endothelial PAS domain-containing protein 1 Epas1 Hif2a HIF-1-alpha-like factor HIF-related factor Hypoxia-inducible factor 2-alpha protein protein mouse Mus musculus Mouse MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLTLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGSKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSDDVAVTEKSNYLFTKLKEEPEELAQLAPTPGDAIISLDFGSQNFDEPSAYGKAILPPGQPWVSGLRSHSAQSESGSLPAFTVPQADTPGNTTPSASSSSSCSTPSSPEDYYSSLENPLKIEVIEKLFAMDTEPRDPGSTQTDFSELDLETLAPYIPMDGEDFQLSPICPEEPLMPESPQPTPQHCFSTMTSIFQPLTPGATHGPFFLDKYPQQLESRKTESEHWPMSSIFFDAGSKGSLSPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWPVGDQSAESLGALPVGSSQLEPPSAPPHVSMFKMRSAKDFGARGPYMMSPAMIALSNKLKLKRQLEYEEQAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTISANMAPDEFTQKSMRGLGQPLRHLPPPQPPSTRSSGENAKTGFPPQCYASQFQDYGPPGAQKVSGVASRLLGPSFEPYLLPELTRYDCEVNVPVPGSSTLLQGRDLLRALDQAT DIP protein P97481 original sequence version: 81 DIP protein P97481 original sequence version: 147 err2_mouse Steroid hormone receptor ERR2 Esrrb Err-2 Err2 Nr3b2 Estrogen-related receptor beta Estrogen receptor-like 2 Nuclear receptor subfamily 3 group B member 2 protein protein mouse Mus musculus Mouse MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKEEFMILKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV DIP protein Q61539 original sequence version: 70 1A0383E7E2ED8BF3 prgc1_mouse Peroxisome proliferator-activated receptor gamma coactivator 1-alpha Ppargc1a Pgc1 Pgc1a Ppargc1 protein protein mouse Mus musculus Mouse MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGAVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHAANHTHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKKSHTQPQSQHAQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPHKANQDNPFKASPKLKPSCKTVVPPPTKRARYSECSGTQGSHSTKKGPEQSELYAQLSKSSGLSRGHEERKTKRPSLRLFGDHDYCQSLNSKTDILINISQELQDSRQLDFKDASCDWQGHICSSTDSGQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGLAMDGLFDDSEDESDKLSYPWDGTQPYSLFDVSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEAYEHERLKRDEYRKEHEKRESERAKQRERQKQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR DIP protein O70343 original sequence version: 117 DIP protein O70343-1 original sequence version: 120 DIP protein O70343 original sequence version: 120 DIP protein O70343 original sequence version: 67 AE73EE2B3A622B05 arnt_mouse Aryl hydrocarbon receptor nuclear translocator Arnt Dioxin receptor, nuclear translocator Hypoxia-inducible factor 1-beta protein protein mouse Mus musculus Mouse MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEVEVNTKFLRCDDDQMCNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIPRSQLGPTANLSLEMGTGQLPSRQQQQQHTELDMVPGRDGLASYNHSQVSVQPVASAGSEHSKPLEKSEGLFAQDRDPRFPEIYPSITADQSKGISSSTVPATQQLFSQGSSFPPNPRPAENFRNSGLTPPVTIVQPSSSAGQILAQISRHSNPAQGSAPTWTSSSRPGFAAQQVPTQATAKTRSSQFGVNNFQTSSSFSAMSLPGAPTASSGTAAYPALPNRGSNFPPETGQTTGQFQARTAEGVGVWPQWQGQQPHHRSSSSEQHVQQTQAQAPSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE DIP protein P53762 original sequence version: 78 DIP protein P53762-1 original sequence version: 143 BDEC0991CD57D402 q15788-1 Nuclear receptor coactivator 1 NCOA1 BHLHE74 SRC1 Class E basic helix-loop-helix protein 74 Protein Hin-2 RIP160 Renal carcinoma antigen NY-REN-52 Steroid receptor coactivator 1 SRC-1A SRC1a protein protein human Homo sapiens Human MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINRQQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE DIP protein Q15788-1 original sequence version: 60 DIP protein Q15788-1 original sequence version: 62 err1_human Steroid hormone receptor ERR1 Estrogen-related receptor alpha Estrogen receptor-like 1 Nuclear receptor subfamily 3 group B member 1 ESRRA ERR1 ESRL1 NR3B1 protein protein human Homo sapiens Human MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMD DIP protein P11474 original sequence version: 102 BAE62DAF0BE6BA96 ncoa1_human Nuclear receptor coactivator 1 Steroid receptor coactivator 1 RIP160 Protein Hin-2 Renal carcinoma antigen NY-REN-52 NCOA1 SRC1 BHLHE74 Class E basic helix-loop-helix protein 74 protein protein human Homo sapiens Human MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINRQQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDNSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE DIP protein Q15788-1 original sequence version: 60 DIP protein Q15788-1 original sequence version: 62 DIP protein Q15788 original sequence version: 88 DIP protein Q15788 original sequence version: 107 DIP protein Q15788 original sequence version: 96 25EF6F389489121E esrra-arnt-1 7 23 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey in vitro In vitro 16 unspecified role unspecified role prey prey in vitro In vitro association association esrrb-arnt-1 5 18 unspecified role unspecified role prey prey in vitro In vitro 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey in vitro In vitro association association esrrb-hif1a-1 3 19 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association esrrg-ncoa1-1 12 22 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction esrrb-arnt-2 15 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 101-176 Region 101-176 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 21 unspecified role unspecified role prey prey in vitro In vitro 16 unspecified role unspecified role prey prey in vitro In vitro association association ppargc1a-esrrb-1 9 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction esrra-hif1a-1 8 16 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association esrrg-arnt-1 4 18 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 21 unspecified role unspecified role prey prey in vitro In vitro association association ppargc1a-esrrg-3 6 20 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 17 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction esrrg-arnt-2 10 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 21 unspecified role unspecified role prey prey in vitro In vitro 16 unspecified role unspecified role prey prey in vitro In vitro association association esrrb-ncoa1-1 11 22 unspecified role unspecified role prey prey in vitro In vitro 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction esrra-hif1a-2 13 23 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 16 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association esrra-arnt-2 14 18 unspecified role unspecified role prey prey in vitro In vitro 23 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey in vitro In vitro association association esrrb-ncoa1-2 2 24 unspecified role unspecified role prey prey in vitro In vitro 19 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction 1 nodeMerge04 2011-10-21 esrrg-ncoa1-2 1 24 unspecified role unspecified role prey prey in vitro In vitro 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction 1 nodeMerge04 2011-10-21