DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68466X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68472X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68467X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68471X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68470X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68473X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68468X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structural plasticity underpins promiscuous binding of the prosurvival protein A1. Structure (London, England : 1993) 2008 imex curation Smits C., Czabotar PE., Hinds MG., Day CL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Smits C., Czabotar PE., Hinds MG., Day CL. DIP original experiment: DIP-68469X Structure (London, England : 1993) 2008 IMEx Structural plasticity underpins promiscuous binding of the prosurvival protein A1. bbc3_mouse Bcl-2-binding component 3 Bbc3 Puma p53 up-regulated modulator of apoptosis protein protein mouse Mus musculus Mouse MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN DIP protein Q99ML1 original sequence version: 37 39A98487FA86D226 bmf_mouse Bcl-2-modifying factor Bmf protein protein mouse Mus musculus Mouse MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVFLFLQNLALNRQENREGVGPW DIP protein Q91ZE9 original sequence version: 42 DAE6EA080F3EA06B b2la1_mouse Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein A1-A Bcl2a1 A1 Bcl2a1a Bfl1 protein protein mouse Mus musculus Mouse MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK DIP protein Q07440 original sequence version: 62 37AD35818E756488 bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS DIP protein O08734 original sequence version: 116 DIP protein O08734 original sequence version: 66 DIP protein O08734 original sequence version: 114 DIP protein O08734 original sequence version: 129 49972D3CA21F4218 bcl2a1-bmf-1 7 10 unspecified role unspecified role unspecified role unspecified role Region 126-152 Region 126-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bbc3-bcl2a1-2 1 9 unspecified role unspecified role unspecified role unspecified role Region 130-155 Region 130-155 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2a1-bid-1 2 12 unspecified role unspecified role unspecified role unspecified role Region 76-109 Region 76-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bak1-bcl2a1-1 5 13 unspecified role unspecified role unspecified role unspecified role Region 64-89 Region 64-89 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2a1-bmf-2 8 10 unspecified role unspecified role unspecified role unspecified role Region 126-152 Region 126-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bbc3-bcl2a1-3 3 9 unspecified role unspecified role unspecified role unspecified role Region 130-155 Region 130-155 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bcl2a1-bid-2 6 12 unspecified role unspecified role unspecified role unspecified role Region 76-109 Region 76-109 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction bak1-bcl2a1-2 4 13 unspecified role unspecified role unspecified role unspecified role Region 64-89 Region 64-89 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Region 1-152 Region 1-152 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction