DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. DIP original experiment: DIP-68801X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. DIP original experiment: DIP-68803X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. DIP original experiment: DIP-68805X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. Only protein-protein interactions ecolx Escherichia coli cd circular dichroism CD CD cd predetermined predetermined participant predetermined Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. DIP original experiment: DIP-68804X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. The crystal structure and dimerization interface of GADD45gamma. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Schrag JD., Jiralerspong S., Banville M., Jaramillo ML., O'Connor-McCourt MD. DIP original experiment: DIP-68802X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure and dimerization interface of GADD45gamma. ga45g_mouse Growth arrest and DNA damage-inducible protein GADD45 gamma Gadd45g Cr6 Cytokine-responsive protein CR6 protein protein mouse Mus musculus Mouse MTLEEVRGQDTVPESTARMQGAGKALHELLLSAHGQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCILISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE DIP protein Q9Z111 original sequence version: 48 4B5996927C57988F gadd45g-1 1 6 unspecified role unspecified role unspecified role unspecified role Q9Z111:p.Leu80Glu L80E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L80E'. Wed May 02 16:32:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu80glu' Tue Jun 30 19:06:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu80Glu' Region 16-159 Region 16-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gadd45g-2 4 6 unspecified role unspecified role unspecified role unspecified role Region 16-159 Region 16-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gadd45g-3 5 6 unspecified role unspecified role unspecified role unspecified role Q9Z111:p.Leu80Glu L80E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L80E'. Wed May 02 17:57:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu80glu' Tue Jun 30 18:35:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu80Glu' Region 16-159 Region 16-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gadd45g-4 3 6 unspecified role unspecified role unspecified role unspecified role Region 16-159 Region 16-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gadd45g-5 2 6 unspecified role unspecified role unspecified role unspecified role Q9Z111:p.Leu80Glu L80E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E This feature has been corrected as a result of our quality control procedures. The original label was 'L80E'. Wed May 02 20:06:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu80glu' Tue Jun 30 18:51:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu80Glu' Region 16-159 Region 16-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction