DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111634X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269275X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269280X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111628X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111658X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-217640X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111622X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111646X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111661X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269299X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111657X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111630X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269289X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269278X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111649X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269306X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269293X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111625X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111653X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111626X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111656X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269291X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269307X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111636X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269300X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269284X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269302X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111644X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269305X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269297X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269283X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-217641X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269287X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269304X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111624X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269308X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111654X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269290X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269285X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111632X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111641X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111650X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111635X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111621X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111633X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269274X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111631X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111640X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111637X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111627X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111648X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111659X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111660X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269272X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269292X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269295X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269286X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269303X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269298X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111643X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269282X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269288X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269296X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111638X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111623X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111642X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111645X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111651X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269281X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269276X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111639X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269279X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111652X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111647X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269273X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111655X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-111629X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269301X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269277X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. BioTechniques 2008 imex curation DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence DeGrado-Warren J., Dufford M., Chen J., Bartel PL., Shattuck D., Frech GC. DIP original experiment: DIP-269294X BioTechniques 2008 IMEx Construction and characterization of a normalized yeast two-hybrid library derived from a human protein-coding clone collection. rain_human Ras-interacting protein 1 RASIP1 protein protein human Homo sapiens Human MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPLPPPPPHVELRRVGAVKAAGGASGSRAKRISQLFRGSGTGTTGSSGAGGPGTPGGAQRWASEKKLPELAAGVAPEPPLATRATAPPGVLKIFGAGLASGANYKSVLATARSTARELVAEALERYGLAGSPGGGPGESSCVDAFALCDALGRPAAAGVGSGEWRAEHLRVLGDSERPLLVQELWRARPGWARRFELRGREEARRLEQEAFGAADSEGTGAPSWRPQKNRSRAASGGAALASPGPGTGSGAPAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQIGTADPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSPAPYVDTFLNAPDILPRHCTVRAGPEHPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYKDPRTGGSGPARPPWLPARPGATPPGPGWAFSCRLCGRGLQERGEALAAYLDGREPVLRFRPREEEALLGEIVRAAAAGSGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLIKEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPLMLWMANTTELLSFVQEKVLEMEKEADQEDPQLCNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRPTLGVFQAALELTSQCELHPDLVSQTFGYLFFFSNASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIATEFFRKLSMAVNLLCVPRTSLLKASWSSLRTDHPTLTPAQLHHLLSHYQLGPGRGPPAAWDPPPAEREAVDTGDIFESFSSHPPLILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANYRHGPPVATSP 470021F91B59EC52 470021F91B59EC52 o00429-1 Dynamin-1-like protein DNM1L DLP1 DRP1 Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-like protein Dynamin-like protein 4 Dynamin-like protein IV Dynamin-related protein 1 DLP1F HdynIV-WT protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW DIP protein O00429-1 original sequence version: 192 DIP protein O00429 original sequence version: 122 q8wxd2-1 Secretogranin-3 SCG3 Secretogranin III UNQ2502/PRO5990 protein protein human Homo sapiens Human MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL DIP protein Q8WXD2-1 original sequence version: 126 q04323-2 UBX domain-containing protein 1 UBXN1 SAKS1 SAPK substrate protein 1 UBA/UBX 33.3 kDa protein protein protein human Homo sapiens Human MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTRNWGSREACLGKGGMQREGAL No experimental confirmation available. DIP protein Q04323-2 original sequence version: 135 75C94CB67C03EB78 q16181-1 Septin-7 SEPTIN7 CDC10 CDC10 protein homolog SEPT7 protein protein human Homo sapiens Human MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF DIP protein Q16181-1 original sequence version: 156 ldb2_human LIM domain-binding protein 2 LDB2 CLIM1 Carboxyl-terminal LIM domain-binding protein 1 LIM domain-binding factor CLIM1 protein protein human Homo sapiens Human MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ E86387BA027F383A E86387BA027F383A tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 gran_human Grancalcin GCA GCL protein protein human Homo sapiens Human MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI 88CA4DDF835AFFE4 88CA4DDF835AFFE4 p40763-2 Signal transducer and activator of transcription 3 STAT3 APRF Acute-phase response factor protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM Contains a phosphotyrosine at position 704. DIP protein P40763-2 original sequence version: 183 A374A32AB9D28077 lrc45_human Leucine-rich repeat-containing protein 45 LRRC45 protein protein human Homo sapiens Human MEEFRRSYSRLCRESGAEPQEAVLQQLHQLPRGRLDLATQSLTVETCRALGKLLPRETLCTELVLSDCMLSEEGATLLLRGLCANTVLRFLDLKGNNLRAAGAEALGKLLQQNKSIQSLTLEWNSLGTWDDAFATFCGGLAANGALQRLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNVGLLGGRALMNCLPSNRTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARVGQLQEALNERHSIINALKAKLQMTEAALALSEQKAQDLGELLATAEQEQLSLSQRQAKELKLEQQEAAERESKLLRDLSAANEKNLLLQNQVDELERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERLDMEKRRCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKAKSQARLEEQQRLAHLEDKLRLLAQARDEAQGACLQQKQVVAEAQTRVSQLGLQVEGLRRRLEELQQELSLKDQERVAEVSRVRVELQEQNGRLQAELAAQEALREKAAALERQLKVMASDHREALLDRESENASLREKLRLREAEIARIRDEEAQRASFLQNAVLAYVQASPVRTLSPPK 27F5D210721459FB 27F5D210721459FB sorcn_human Sorcin 22 kDa protein CP-22 V19 SRI protein protein human Homo sapiens Human MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV A4829C7650A5E3FA A4829C7650A5E3FA q15642-2 Cdc42-interacting protein 4 A W TRIP10 CIP4 STOT STP Protein Felic Salt tolerant protein Thyroid receptor-interacting protein 10 protein protein human Homo sapiens Human MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQREALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTSPIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTLN DIP protein Q15642-2 original sequence version: 163 9C9D72EA734BC6E2 dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 F9521A376B785B71 lhx4_human LIM/homeobox protein Lhx4 LHX4 protein protein human Homo sapiens Human MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF 6499F38E78B79FD1 6499F38E78B79FD1 cip4_human Cdc42-interacting protein 4 TRIP10 CIP4 Thyroid receptor-interacting protein 10 Protein Felic Salt tolerant protein STOT STP protein protein human Homo sapiens Human MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKPRPPPLSPLGGPVPSALPNGPPSPRSGRDPLAILSEISKSVKPRLASFRSLRGSRGTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQREALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTSPIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTLN A9BFE85520C7ABC5 A9BFE85520C7ABC5 lmo4_human LIM domain transcription factor LMO4 Breast tumor autoantigen LIM domain only protein 4 LMO4 protein protein human Homo sapiens Human MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC C8AC295144AD7787 C8AC295144AD7787 batf_human Basic leucine zipper transcriptional factor ATF-like SF-HT-activated gene 2 protein BATF B-cell-activating transcription factor protein protein human Homo sapiens Human MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP 7FD633C6F1963DF4 7FD633C6F1963DF4 pa24a_human Cytosolic phospholipase A2 PLA2G4A CPLA2 PLA2G4 Phospholipase A2 group IVA protein protein human Homo sapiens Human MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA EE71CA0EBE617856 EE71CA0EBE617856 ddit3_human DNA damage-inducible transcript 3 protein CHOP10 C/EBP-homologous protein DDIT3 CHOP GADD153 Growth arrest and DNA damage-inducible protein GADD153 C/EBP-homologous protein 10 C/EBP zeta CCAAT/enhancer-binding protein homologous protein protein protein human Homo sapiens Human MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA 31905293FB1FBBE2 31905293FB1FBBE2 ubp7_human Ubiquitin carboxyl-terminal hydrolase 7 USP7 HAUSP Ubiquitin thioesterase 7 Ubiquitin-specific-processing protease 7 Deubiquitinating enzyme 7 Herpesvirus-associated ubiquitin-specific protease protein protein human Homo sapiens Human MNHQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN DIP protein Q93009 original sequence version: 71 DIP protein Q93009 original sequence version: 67 DIP protein Q93009-1 original sequence version: 180 DIP protein Q93009 original sequence version: 173 DIP protein Q93009 original sequence version: 91 DIP protein Q93009 original sequence version: 163 DIP protein Q93009 original sequence version: 176 DIP protein Q93009-1 original sequence version: 128 DIP protein Q93009 original sequence version: 128 F1A5A5C421396E45 prs8_human 26S proteasome regulatory subunit 8 PSMC5 SUG1 Proteasome 26S subunit ATPase 5 Proteasome subunit p45 p45/SUG Thyroid hormone receptor-interacting protein 1 26S proteasome AAA-ATPase subunit RPT6 protein protein human Homo sapiens Human MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 29C6410C4A85A7F7 29C6410C4A85A7F7 gipc1_human PDZ domain-containing protein GIPC1 C19orf3 GIPC GIPC1 RGS19IP1 RGS19-interacting protein 1 GAIP C-terminus-interacting protein RGS-GAIP-interacting protein Tax interaction protein 2 Synectin protein protein human Homo sapiens Human MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY DIP protein O14908 original sequence version: 131 AA980A4B907E3FD9 cap1_human Adenylyl cyclase-associated protein 1 CAP1 CAP protein protein human Homo sapiens Human MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG 7789D1FAC0D1AB7B 7789D1FAC0D1AB7B sept5_human Septin-5 SEPTIN5 Cell division control-related protein 1 PNUTL1 Peanut-like protein 1 SEPT5 protein protein human Homo sapiens Human MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQRMKQQMQDQ 47054765DEA10D33 47054765DEA10D33 hspb1_human Heat shock protein beta-1 HSPB1 HSP27 HSP28 Heat shock 27 kDa protein Stress-responsive protein 27 Estrogen-regulated 24 kDa protein 28 kDa heat shock protein protein protein human Homo sapiens Human MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK 1B4DC44A6F6606D5 1B4DC44A6F6606D5 tedc1_human Tubulin epsilon and delta complex protein 1 TEDC1 C14orf80 protein protein human Homo sapiens Human MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEATSALWQLLFRVLSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTVCQCEALASPGPPAPHMEAEGPVDVRHVQWLMGKLRFRWRQLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQVSGAGAAQNLDLAYPKCLHSFCTPGMGPRTFWNDLWLVCEQPGLLPGDWAAPLDPGGASACSLLSPFRALLRTLERENQRLEAVLAWRRSELVFWRWMDTVLGTCAPEVPAAASQPTFLPWVPERGGGELDLVVRELQALEEELREAAERRRAAWEAKAGGCGRGPEWSAARRASREAVEKELGALQQCWERDGGPAQPHGPHRLVRREDGAAGDRDLRAAVVIRTLRSQEACLEAVLRRLQGQCRQELARLVGARPGLIWIPPPGR 3E34FACE82E0EACF 3E34FACE82E0EACF o14908-1 PDZ domain-containing protein GIPC1 GIPC1 C19orf3 GIPC RGS19IP1 GAIP C-terminus-interacting protein RGS-GAIP-interacting protein RGS19-interacting protein 1 Synectin Tax interaction protein 2 protein protein human Homo sapiens Human MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY DIP protein O14908-1 original sequence version: 148 rilp_human Rab-interacting lysosomal protein RILP PP10141 protein protein human Homo sapiens Human MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVRALELLEQAAVGPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELRAHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQEPEWATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA 1057A1DAC2FFED94 1057A1DAC2FFED94 p62195-1 26S proteasome regulatory subunit 8 PSMC5 SUG1 26S proteasome AAA-ATPase subunit RPT6 Proteasome 26S subunit ATPase 5 Proteasome subunit p45 Thyroid hormone receptor-interacting protein 1 p45/SUG protein protein human Homo sapiens Human MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK DIP protein P62195-1 original sequence version: 134 p30626-1 Sorcin 22 kDa protein CP-22 V19 SRI protein protein human Homo sapiens Human MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV DIP protein P30626-1 original sequence version: 174 A4829C7650A5E3FA pfd6_human Prefoldin subunit 6 PFDN6 HKE2 PFD6 Protein Ke2 protein protein human Homo sapiens Human MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA 8F138EAAE512A312 8F138EAAE512A312 q8tap4-1 LIM domain only protein 3 LMO3 RBTN3 RBTNL2 RHOM3 Neuronal-specific transcription factor DAT1 Rhombotin-3 protein protein human Homo sapiens Human MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR DIP protein Q8TAP4-1 original sequence version: 115 p31350-1 Ribonucleoside-diphosphate reductase subunit M2 RRM2 RR2 Ribonucleotide reductase small chain Ribonucleotide reductase small subunit protein protein human Homo sapiens Human MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF DIP protein P31350-1 original sequence version: 174 o43679-1 LIM domain-binding protein 2 LDB2 CLIM1 Carboxyl-terminal LIM domain-binding protein 1 LIM domain-binding factor CLIM1 CLIM1a a protein protein human Homo sapiens Human MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ DIP protein O43679-1 original sequence version: 52 q99961-1 Endophilin-A2 SH3GL1 CNSA1 SH3D2B EEN fusion partner of MLL Endophilin-2 Extra eleven-nineteen leukemia fusion gene protein SH3 domain protein 2B SH3 domain-containing GRB2-like protein 1 protein protein human Homo sapiens Human MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ DIP protein Q99961-1 original sequence version: 167 DIP protein Q99961-1 original sequence version: 152 borc6_human BLOC-1-related complex subunit 6 BORCS6 C17orf59 Lysosome-dispersing protein protein protein human Homo sapiens Human MESSRGRPGPETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLSGAGSRRGAPGAEHEPSLSSRHKNPAPPEGKPSSGRDCRRGGPGGGMDVEQQEEEDNDEEAAAGSRAGRSFSSRLQDSRSLDGLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPPPPPSAPARPCPAPAPTPTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEVLEALCK BBA89770528FA9E9 BBA89770528FA9E9 sh3g1_human Endophilin-A2 Endophilin-2 SH3 domain-containing GRB2-like protein 1 SH3 domain protein 2B Extra eleven-nineteen leukemia fusion gene protein EEN fusion partner of MLL SH3GL1 CNSA1 SH3D2B protein protein human Homo sapiens Human MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ 6E5BE978BC955077 6E5BE978BC955077 q15019-1 Septin-2 SEPTIN2 DIFF6 KIAA0158 NEDD5 Neural precursor cell expressed developmentally down-regulated protein 5 SEPT2 protein protein human Homo sapiens Human MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGHHV DIP protein Q15019-1 original sequence version: 144 DIP protein Q15019-1 original sequence version: 83 DIP protein Q15019 original sequence version: 148 DIP protein Q15019 original sequence version: 152 12CCBBE30806F92F sept2_human Septin-2 SEPTIN2 DIFF6 KIAA0158 NEDD5 Neural precursor cell expressed developmentally down-regulated protein 5 SEPT2 protein protein human Homo sapiens Human MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGHHV 12CCBBE30806F92F 12CCBBE30806F92F rir2_human Ribonucleoside-diphosphate reductase subunit M2 RRM2 RR2 Ribonucleotide reductase small subunit Ribonucleotide reductase small chain protein protein human Homo sapiens Human MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF DIP protein P31350 original sequence version: 153 DIP protein P31350 original sequence version: 118 10E6F5F84D34DA94 q13137-2 Calcium-binding and coiled-coil domain-containing protein 2 CALCOCO2 NDP52 Antigen nuclear dot 52 kDa protein Nuclear domain 10 protein NDP52 Nuclear dot protein 52 protein protein human Homo sapiens Human MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL DIP protein Q13137-2 original sequence version: 130 No experimental confirmation available. p42684-1 Tyrosine-protein kinase ABL2 Abelson tyrosine-protein kinase 2 ABL2 ABLL ARG Abelson murine leukemia viral oncogene homolog 2 Abelson-related gene protein Tyrosine-protein kinase ARG 1BLCTL IB protein protein human Homo sapiens Human MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR DIP protein P42684-1 original sequence version: 189 DIP protein P42684 original sequence version: 123 lmo3_human LIM domain only protein 3 LMO3 RBTN3 RHOM3 Neuronal-specific transcription factor DAT1 Rhombotin-3 RBTNL2 protein protein human Homo sapiens Human MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR 05284546BA5EC226 05284546BA5EC226 sep11_human Septin-11 SEPTIN11 SEPT11 protein protein human Homo sapiens Human MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNASFT D467F1F315FFD028 D467F1F315FFD028 pepd_human Xaa-Pro dipeptidase Proline dipeptidase Imidodipeptidase Peptidase D PEPD PRD protein protein human Homo sapiens Human MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK E8C4A2497E44BA22 E8C4A2497E44BA22 maga3_human Melanoma-associated antigen 3 MAGEA3 MAGE3 Antigen MZ2-D Cancer/testis antigen 1.3 MAGE-3 antigen protein protein human Homo sapiens Human MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE 3F5EB13D1C9946A1 3F5EB13D1C9946A1 cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK DIP protein P02511 original sequence version: null AE08BED46B7849CB DIP protein P02511 original sequence version: 195 DIP protein P02511 original sequence version: 130 DIP protein P02511 original sequence version: 131 DIP protein P02511 original sequence version: 151 DIP protein P02511 original sequence version: 167 DIP protein P02511 original sequence version: 154 DIP protein P02511 original sequence version: 146 AE08BED46B7849CB scg3_human Secretogranin-3 SCG3 Secretogranin III UNQ2502/PRO5990 protein protein human Homo sapiens Human MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL 5E6BBDDFFF3B8D82 5E6BBDDFFF3B8D82 abl2_human Tyrosine-protein kinase ABL2 Abelson tyrosine-protein kinase 2 ABL2 ABLL ARG Abelson murine leukemia viral oncogene homolog 2 Abelson-related gene protein Tyrosine-protein kinase ARG protein protein human Homo sapiens Human MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR ED93869BC2B14FAA ED93869BC2B14FAA ubxn1_human UBX domain-containing protein 1 UBXN1 SAKS1 SAPK substrate protein 1 UBA/UBX 33.3 kDa protein protein protein human Homo sapiens Human MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS E4E0C8BBAC93F2BB E4E0C8BBAC93F2BB bbln_human Bublin coiled-coil protein BBLN C9orf16 UPF0184 protein C9orf16 EST00098 protein protein human Homo sapiens Human MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP EBE1D0AFAAD6DABB EBE1D0AFAAD6DABB p35638-1 DNA damage-inducible transcript 3 protein DDIT3 CHOP CHOP10 GADD153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA damage-inducible protein GADD153 protein protein human Homo sapiens Human MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA DIP protein P35638-1 original sequence version: 164 q9nva2-1 Septin-11 SEPTIN11 SEPT11 protein protein human Homo sapiens Human MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNASFT DIP protein Q9NVA2-1 original sequence version: 135 atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 DIP protein P18848 original sequence version: 181 DIP protein P18848 original sequence version: 117 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. 3BBB7379DC3B0D07 tsnax_human Translin-associated protein X Translin-associated factor X TSNAX TRAX protein protein human Homo sapiens Human MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS D38B0DD96B50C0B9 DIP protein Q99598 original sequence version: 139 DIP protein Q99598 original sequence version: 93 The protein could not be merged with EBI-12908040 because of some conflicts with the protein sequence (features which cannot be shifted). D38B0DD96B50C0B9 tha11_human THAP domain-containing protein 11 THAP11 HRIHFB2206 protein protein human Homo sapiens Human MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM 25235D20CB54D8C2 25235D20CB54D8C2 q99719-1 Septin-5 SEPTIN5 Cell division control-related protein 1 PNUTL1 Peanut-like protein 1 SEPT5 protein protein human Homo sapiens Human MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQRMKQQMQDQ DIP protein Q99719-1 original sequence version: 70 sept7_human Septin-7 SEPTIN7 CDC10 CDC10 protein homolog SEPT7 protein protein human Homo sapiens Human MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF DIP protein Q16181 original sequence version: 122 DIP protein Q16181 original sequence version: 130 946A08C54B7124FF p12955-1 Xaa-Pro dipeptidase PEPD PRD Imidodipeptidase Peptidase D Proline dipeptidase protein protein human Homo sapiens Human MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK DIP protein P12955-1 original sequence version: 191 sept6_human Septin-6 SEPTIN6 KIAA0128 SEP2 SEPT6 protein protein human Homo sapiens Human MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE DIP protein Q14141 original sequence version: 120 DIP protein Q14141 original sequence version: 152 DIP protein Q14141 original sequence version: 128 E684AE6A93B32362 maga1_human Melanoma-associated antigen 1 MAGE-1 antigen Antigen MZ2-E Cancer/testis antigen 1.1 MAGEA1 MAGE1 MAGE1A protein protein human Homo sapiens Human MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV 544EEB1F9F4E9D33 544EEB1F9F4E9D33 q96na2-1 Rab-interacting lysosomal protein RILP PP10141 protein protein human Homo sapiens Human MEPRRAAPGVPGWGSREAAGSASAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVRALELLEQAAVGPAPDSLQVSAQPAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELRAHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAMQTQLRAAQDRERERQQPGEAATPQAKERARGQAGRPGHQHGQEPEWATAGAGAPGNPEDPAEAAQQLGRPSEAGQCRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSEDEAGPWILLSDDKGDHPPPPESKIQSFFGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCLGASAAPEA DIP protein Q96NA2-1 original sequence version: 125 DIP protein Q96NA2-1 original sequence version: 54 stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D ssbp3_human Single-stranded DNA-binding protein 3 SSBP3 SSDP SSDP1 Sequence-specific single-stranded-DNA-binding protein protein protein human Homo sapiens Human MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV DBBB169D4EE10536 DBBB169D4EE10536 caco2_human Calcium-binding and coiled-coil domain-containing protein 2 CALCOCO2 NDP52 Nuclear domain 10 protein NDP52 Antigen nuclear dot 52 kDa protein Nuclear dot protein 52 protein protein human Homo sapiens Human MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL 609B121DA1A9DCB8 609B121DA1A9DCB8 ssbp2_human Single-stranded DNA-binding protein 2 Sequence-specific single-stranded-DNA-binding protein 2 SSBP2 SSDP2 protein protein human Homo sapiens Human MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV DIP protein P81877-1 original sequence version: 135 DIP protein P81877 original sequence version: 75 EC6F9B08EBFF673A xage1d X antigen family, member 1D isoform 1c protein protein human Homo sapiens Human septin 5-septin 2-1 44 119 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 104 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-lmo3-1 7 123 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-rela-1 65 87 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-psmc5-1 35 101 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmn1l-magea1-1 18 141 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 93 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-c14orf80-1 20 106 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 99 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-gca-1 50 88 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 91 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-lrrc45-1 4 90 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association usp7-pepd-1 77 125 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 100 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cryab-cryab-3 12 127 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association septin 5-septin 11-1 47 124 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 104 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmn1l-magea3-1 40 126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 93 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-lhx4-1 45 94 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-calcoco2-2 1 145 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 91 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association septin 5-septin 6-1 43 140 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 104 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-rilp-1 24 108 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-lmo4-1 49 96 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmn1l-scg3-1 64 128 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 93 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association abl2-trip10-1 71 95 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 129 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-stat3-1 48 143 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 91 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-xage1d-1 41 147 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-ssbp3-1 66 144 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-atf4-2 60 134 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 99 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-cap1-1 28 103 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmn1l-rrm2-1 67 120 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 93 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association septin 5-septin 6-2 8 140 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 104 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmn1l-sh3gl1-1 74 117 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 93 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-tsnax-1 51 135 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-saks1-1 15 130 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-rasip1-1 42 81 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-ssbp2-1 68 146 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association septin 5-septin 7-1 73 138 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 104 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-sri-1 19 91 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 91 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cryab-hspb1-3 37 105 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-ssbp3-2 76 144 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-pfdn6-1 21 111 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-c17orf59-1 11 116 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-ssbp3-3 5 144 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 86 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-batf-2 52 97 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 99 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-gipc1-1 53 102 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 99 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-c9orf16-3 9 131 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cryab-cryab-6 6 127 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1 nodeMerge04 2011-10-22 cryab-hspb1-4 32 105 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 127 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1 nodeMerge04 2011-10-22 dnm1l-scg3-1 69 83 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 82 unspecified role unspecified role bait bait 500-697 binding region 500-697 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 600-736 binding region 600-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 625-736 binding region 625-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-rela-2 38 87 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait 1-129 binding region 1-129 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-batf-3 36 97 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 132 unspecified role unspecified role bait bait 75-167 binding region 75-167 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 90-165 binding region 90-165 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sept5-sept2-4 54 118 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 137 unspecified role unspecified role bait bait 1-230 binding region 1-230 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 25-290 binding region 25-290 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-psmc5-2 10 109 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait 100-301 binding region 100-301 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 196-314 binding region 196-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 230-314 binding region 230-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-ubxn1-1 13 84 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait 1-121 binding region 1-121 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 1-129binding region 1-129binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-ssbp3-4 59 144 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait 1-300 binding region 1-300 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cryab-cryab-7 75 127 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 127 unspecified role unspecified role bait bait 1-78 binding region 1-78 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 -175 binding region 3 -175 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association abl2-trip10-2 61 92 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 122 unspecified role unspecified role bait bait 900-1080 binding region 900-1080 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 950-1100 binding region 950-1100 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sept5-sept11-4 46 133 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 137 unspecified role unspecified role bait bait 25-290 binding region 25-290 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 30-330 binding region 30-330 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-lmo3-2 31 112 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-c9orf16-4 78 131 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait 100-301 binding region 100-301 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 196-314 binding region 196-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 230-314 binding region 230-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association usp7-pepd-2 16 139 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 100 unspecified role unspecified role bait bait 670-920 binding region 670-920 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 699-910 binding region 699-910 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sept5-sept7-1 17 85 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 137 unspecified role unspecified role bait bait 1-230 binding region 1-230 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 25-290 binding region 25-290 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ldb2-rasip1-2 22 81 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dnm1l-magea3-1 2 126 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 82 unspecified role unspecified role bait bait 500-697 binding region 500-697 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 600-736 binding region 600-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 625-736 binding region 625-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-atf4-3 23 134 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 132 unspecified role unspecified role bait bait 75-167 binding region 75-167 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 90-165 binding region 90-165 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-gipc1-2 25 107 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 132 unspecified role unspecified role bait bait 90-165 binding region 90-165 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-ssbp2-2 55 146 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait 1-300 binding region 1-300 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-stat3-2 26 89 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 110 unspecified role unspecified role bait bait 26-163 binding region 26-163 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cryab-hspb1-5 56 105 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 127 unspecified role unspecified role bait bait 1-78 binding region 1-78 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 -175 binding region 3 -175 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 60-170 binding region 60-170 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-lhx4-2 70 94 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ddit3-c14orf80-2 58 106 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 132 unspecified role unspecified role bait bait 75-167 binding region 75-167 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 90-165 binding region 90-165 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-cap1-2 39 103 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait 1-121 binding region 1-121 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 1-129 binding region 1-129 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-calcoco2-3 79 121 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 110 unspecified role unspecified role bait bait 26-163 binding region 26-163 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dnm1l-magea1-1 27 141 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 82 unspecified role unspecified role bait bait 500-697 binding region 500-697 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 600-736 binding region 600-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dnm1l-rrm2-1 57 113 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 82 unspecified role unspecified role bait bait 500-697 binding region 500-697 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 600-736 binding region 600-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 625-736 binding region 625-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sept5-sept6-3 14 140 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 137 unspecified role unspecified role bait bait 25-290 binding region 25-290 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 30-330 binding region 30-330 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-sri-2 80 110 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 110 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-rilp-2 72 142 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait 1-300 binding region 1-300 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dnm1l-sh3gl1-1 33 115 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 82 unspecified role unspecified role bait bait 500-697 binding region 500-697 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 600-736 binding region 600-736 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-lrrc45-2 29 90 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait 196-314 binding region 196-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 230-314 binding region 230-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pla2g4a-borcs6-1 30 116 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 98 unspecified role unspecified role bait bait 1-121 binding region 1-121 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 1-129 binding region 1-129 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association sri-gca-2 34 88 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 110 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-tsnax-2 62 135 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ldb2-lmo4-2 3 96 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 114 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association thap11-pfdn6-2 63 111 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 136 unspecified role unspecified role bait bait 100-301 binding region 100-301 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 196-314 binding region 196-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 230-314 binding region 230-314 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association